SecReT6
Protein ID: 126641352
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1306
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1532650..1532913 [+]
Producthypothetical protein
NotePAAR
UniProt IDA3M490
KEGG IDacb:A1S_1306
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.90E-22, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|126641352|ref|YP_001084336.1| hypothetical protein A1S_1306 [Acinetobacter baumannii ATCC 17978]
MASPYITIGCPTTGGGQVISGNSAFLIDGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1532650-1532913 Acinetobacter baumannii ATCC 17978, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGATGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCTGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG
 Primer design