SecReT6
Protein ID: 126641354
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1308
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1536114..1536935 [+]
Producthypothetical protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 0.0083, Aligned region: 3..22
Protein Sequence: 273 a.a.     [Download]
>gi|126641354|ref|YP_001084338.1| hypothetical protein A1S_1308 [Acinetobacter baumannii ATCC 17978]
MVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLYHE
NIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEWNVLKQTLDHLMGLDSPSFAAID
SAFETIHSTLRKIYKAEAFGTGLAPSQEEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAMK
VLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPKNEYE
 
Nucleotide Sequence: 822 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1536114-1536935 Acinetobacter baumannii ATCC 17978, complete genome
ATGGTAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATATTGGCAGGATATTCATCCGATTATTG
AAGATGATGATTTGGATCAGCGTATTGGTTTATTACAAGGTCTTATTAATCAGTTGCCAATGCTGTTGAA
GAAAGTACCTTTAACCAACACAGCTCCTTATTATAACTTGCTTGATTATGATAATTTTCTATATCACGAA
AATATACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATC
AAGCGATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGA
GTGGAATGTTTTAAAGCAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGAT
TCTGCATTTGAAACAATACACAGCACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTG
CGCCGAGCCAAGAAGAACAGGCCGCTGTCATCACGACACCGTCTATGGAAAATCAAGTGCCTGTACAAAT
CGTATCAGACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGGCCAATCGCGAGCAAGCAATGAAA
GTGCTGCAAGAAATAGCTGATTATTTTCAAGCAAATGAGCCACATAGTCCTGTGAGCTATATGCTCCAAA
AAACAATTAAATGGAGCCAAATGCCGCTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCCATT
GCAAATGGTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA
 Primer design