SecReT6
Protein ID: 126641355
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1309
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1537150..1538316 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-108, Aligned region: 2..385
Protein Sequence: 388 a.a.     [Download]
>gi|126641355|ref|YP_001084339.1| hypothetical protein A1S_1309 [Acinetobacter baumannii ATCC 17978]
MIWQDGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPVLQANKQNLIDQNQSQKGRYQSHLVETHDLF
TNATEADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVS
NLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELL
RLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDK
ITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFE
IEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1537150-1538316 Acinetobacter baumannii ATCC 17978, complete genome
ATGATTTGGCAAGACGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTG
ATGAGCTTAATTTACGTGGTGAGATGGTCATCTATTTGGCATTACCAGTATTACAAGCCAATAAACAAAA
TTTAATCGATCAAAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATGATCTGTTC
ACAAACGCGACAGAGGCCGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATA
GTAATCCTGATCATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGG
TGCTTTTGAAATTGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCA
AATTTAAAAAGAACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATG
AGCAGAAATTAATTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGC
TCATGCTGGTCTGAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGATTATTCTTTGAATTGCTA
CGTTTAGCAGGTTCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGTTGCCTGCATATAAACATC
ATAATTTGCAAGAGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAG
TCGTTACATCAGTATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAG
ATTACTCGAGATACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAA
TCGTTCCTCTACGTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGC
AATTCCATTACATCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAA
ATCGAACCGCATCATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTG
GATTCCAAGATATCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA
 Primer design