SecReT6
Protein ID: 126641356
SecReT6 ID195
T6SS typei4b
Gene symbol-
Locus tagA1S_1310
StrainAcinetobacter baumannii ATCC 17978
Repliconchromosome [GenBank: NC_009085] [Browse all T6SS(s) in this replicon]
Location [Strand]1538493..1539140 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-49, Aligned region: 2..186
Protein Sequence: 215 a.a.     [Download]
>gi|126641356|ref|YP_001084340.1| hypothetical protein A1S_1310 [Acinetobacter baumannii ATCC 17978]
MPADPQRFREKILDLLNRFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQL
SLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGK
KVAFSPFSAIPDQIRNIIHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHI
TIYLP
 
Nucleotide Sequence: 648 bp     [Download]
>gi|126640115|ref|NC_009085.1|:1538493-1539140 Acinetobacter baumannii ATCC 17978, complete genome
GTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAATCGATTTGAGCAACAAGCGA
AAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTTGTGCGCTAATTGATGAAAC
GATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTTAATTAGCCCATTACAGTTA
AGTCTGTTTGGTTCTCAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAGCAACTACGTAGTCGTGGAA
AAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTTTTCAGGGTAAATACCGAAT
TGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAATTGATTATCTGAAAGGGAAA
AAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATTATCCATCGTGAGCTACCTT
TTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAGGTTTAAGATTTATGCTTAA
CAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCCACAAGAGCAGGCACATATT
ACTATTTACTTACCTTGA
 Primer design