SecReT6
Protein ID: 134293122
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4427
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1253782..1254060 [-]
Producthypothetical protein
NotePAAR
UniProt IDA4JM90
KEGG IDbvi:Bcep1808_4427
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.30E-08, Aligned region: 8..51
PAAR_motif [PF05488], Evalue: 2.30E-08, Aligned region: 66..88
Protein Sequence: 92 a.a.     [Download]
>gi|134293122|ref|YP_001116858.1| hypothetical protein Bcep1808_4427 [Burkholderia vietnamiensis G4]
MSKIMMALKGNTTTTGGVVLDGDGAMLDDGVPLAKHMGLASCPRCGQNGPIFGTALSWGLTSTRGVRDND
IVMCRCPPGTNRVIARSTIYDE
 
Nucleotide Sequence: 279 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c1254060-1253782 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGAGCAAGATCATGATGGCCCTGAAGGGCAATACGACCACGACCGGTGGTGTCGTGCTTGACGGTGACG
GGGCCATGCTGGATGACGGCGTGCCGCTCGCAAAACATATGGGGCTGGCGTCATGCCCGCGCTGCGGTCA
GAACGGGCCCATTTTCGGAACGGCATTGAGCTGGGGACTGACGAGCACGCGGGGCGTGCGCGACAACGAC
ATCGTGATGTGCCGATGCCCGCCCGGGACCAACCGCGTCATCGCACGCTCGACCATTTACGACGAGTAG
 Primer design