SecReT6
Protein ID: 134293123
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4428
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1254088..1254519 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA4JM91
KEGG IDbvi:Bcep1808_4428
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-18, Aligned region: 31..116
Protein Sequence: 143 a.a.     [Download]
>gi|134293123|ref|YP_001116859.1| GPW/gp25 family protein [Burkholderia vietnamiensis G4]
MWTGPGLFERITGHFADGSAVDDFAAEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDLSAIYRHLPSS
AHKLQRAIEATLLAYEPRLKKVEIEIHPPEPGMLISFTMACHLHREGLVRFGTNFMPDGKTRLRMLQAAL
DRY
 
Nucleotide Sequence: 432 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c1254519-1254088 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTGGACAGGTCCTGGGTTGTTCGAGCGAATCACCGGACATTTTGCGGACGGTTCGGCAGTAGACGACT
TCGCCGCGGAGGTTCAGGTCTTTCTTTCGGTTCGCGACAATATCGAGCGCATCTTGAACAGCCGACGCGG
ATCGCTCGCTCATCTACCGGACTACGGGCTGGACGACCTATCGGCGATCTATCGGCATCTGCCGTCCTCC
GCGCACAAGCTCCAGCGCGCGATCGAGGCCACCCTGCTCGCCTACGAACCGCGGCTCAAGAAGGTGGAAA
TCGAAATTCATCCGCCCGAACCAGGCATGTTGATCAGCTTCACGATGGCTTGTCATTTGCATCGCGAAGG
CTTGGTCCGCTTCGGCACGAATTTCATGCCGGACGGTAAGACCCGCCTGCGCATGCTCCAGGCTGCACTG
GATCGGTACTGA
 Primer design