SecReT6
Protein ID: 134293125
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4430
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1255191..1256537 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4JM93
KEGG IDbvi:Bcep1808_4430, bvi:Bcep1808_5148
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.50E-131, Aligned region: 18..445
Protein Sequence: 448 a.a.     [Download]
>gi|134293125|ref|YP_001116861.1| hypothetical protein Bcep1808_4430 [Burkholderia vietnamiensis G4]
MKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPDAWGAVHVALDSEALSVNRLQCTALGLRLPD
GTLIDSETADWLPAARSLDDVPTTVDSVTVLAGVALMDAQGGNCVEPGEKPARPRRVTREYKHVADLNGD
GQEEISVERNVVALLFDFEQAGDYVTCPIARLVRTPQGRFEQDKSFVPPCLFLSASDRLVHRAQRISEIL
SAKSASLAVRRKERSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTF
STTESLQAIPLYDHHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRATTWLGRINDERLTEGAEYYL
SVQAAMPAHALIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAIPVRIENQYFALDSNDAAFKR
MIDAHACQIYVPASIPEASLELYAVLPS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c1256537-1255191 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGAAGATAACCAGACCGCTGTGGGCCAAGGGGATTTTCATGACGCCGCAGCACTTCCAGCAGCAGGCGA
TATGGGAACAATACGTCCATGACCGTGTAGCCCGTATCGCAAGCCCCGACGCTTGGGGTGCCGTCCACGT
TGCGCTCGACAGCGAAGCACTGAGCGTCAATCGACTGCAGTGCACGGCGCTCGGGCTGCGCCTGCCGGAC
GGTACGCTGATCGATAGTGAAACGGCCGACTGGCTTCCTGCGGCACGCAGTCTCGACGACGTGCCGACAA
CGGTCGACAGCGTGACCGTGCTTGCTGGTGTAGCACTGATGGACGCTCAGGGCGGCAACTGCGTCGAACC
CGGCGAAAAGCCTGCGCGGCCGCGGCGCGTGACCCGCGAATACAAGCACGTTGCCGATCTGAACGGCGAC
GGACAGGAAGAAATCAGCGTCGAGCGCAACGTGGTAGCCCTTCTGTTCGACTTCGAGCAGGCCGGAGACT
ACGTCACCTGTCCGATCGCGCGGCTCGTGCGCACGCCACAAGGGCGGTTCGAACAGGACAAGAGCTTCGT
CCCGCCGTGCCTGTTCCTGTCGGCGAGCGATCGCCTCGTGCATCGCGCGCAGCGCATCTCCGAAATCCTG
TCTGCCAAGAGCGCCAGCCTTGCAGTGCGCCGCAAAGAGCGCTCGGATCAGATCGCCGATTTCGCCGTGT
CCGACGTGGCGCTCTTCTGGCTGTTACATAGCGTGAATAGCACCTGGCCCGAACTCGCCCGTCTCGTACA
GGCGCCGGACCAGCATCCGGAACGGCTCTACGCCGTGCTCGCCCGCTTGGCCGGCTCACTGCTGACGTTC
TCTACGACCGAGTCGCTCCAGGCGATTCCGCTATACGATCACCACGCGCCGGAGCCGATGTTTGCCGAGC
TCGAATCGCTGATCAGAACACTGCTCGACGCCGTGATTCCGTCCCGAGTCGTGCCGATTGCACTCGAGCG
CGTGCGCGCGACCACATGGCTCGGCCGAATCAACGACGAGCGGCTGACGGAAGGCGCTGAATACTATCTG
TCGGTTCAGGCCGCCATGCCCGCACACGCCCTCATCGAGCACCTGCCGCGCCTCTGCAAGGTCGGCGCAC
CGGACGAAGTCGAGCAGATCGTCAATTCCGCACTGCTCGGCATCGCACTGCGACCGATGTCGCGCCTGCC
TGCCGCGATTCCCGTGCGGATAGAAAACCAGTACTTCGCGCTGGACAGCAACGATGCCGCGTTCAAGCGG
ATGATCGACGCGCATGCCTGCCAGATCTACGTGCCGGCGTCGATTCCTGAAGCGTCGCTCGAGCTGTATG
CGGTATTGCCGTCATGA
 Primer design