SecReT6
Protein ID: 134293126
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4431
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1256594..1258015 [-]
Producthypothetical protein
NoteTssC
UniProt IDA4JM94
KEGG IDbvi:Bcep1808_4431
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.40E-167, Aligned region: 47..469
Protein Sequence: 473 a.a.     [Download]
>gi|134293126|ref|YP_001116862.1| hypothetical protein Bcep1808_4431 [Burkholderia vietnamiensis G4]
MSHSSVIRPCQMQRPMSEGAQCDQYTDAKLSSEMRINTIACIDSDLIDWYLAELDDQLGRQLDAILHHCA
FQTLESTWRGLQFLVDRTDFRQNVKIEVLDVSKEALRQDFEDAPDIIQSGLFRLTYVGEYDMPGGQPIAA
IVSAFEFDHGGPDIALLRNISKVAAAAHMPFIGAVSPAFFGKTTMEAVAGIRDLPSWFERAEYLKWKGFR
ETEDARYIALTMPRFLARLPYGFDTMPVRAFNYTENVRESGRSAYLWTSAAFAFAVNIVRSFVRNGWCVQ
IRGPQAGGVINDIPAHRYDLGAGQLGKISTDALISETRENEFADIGLIPLSYTRNHDQTCFFSAHSTQRP
RSYDARDASANSRINARLPYIFLLSRIAHYLKLIQRENIGTTRDSRLLELELNTWIKSLVTEMTDPGDEL
QAAHPLRQAKVTVEDIEDNPGFFRIKLFIVPHFQIEGVDINLSLVSQMPKAKH
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c1258015-1256594 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTCGCATTCCTCTGTTATCCGGCCATGCCAGATGCAACGTCCGATGAGTGAAGGCGCTCAGTGCGACC
AATACACCGACGCCAAATTATCTTCAGAAATGCGCATAAATACGATTGCGTGCATCGATTCCGATTTGAT
CGATTGGTATCTGGCTGAATTGGACGATCAACTCGGCAGACAGCTCGACGCCATCCTCCACCACTGCGCA
TTTCAGACACTCGAATCGACGTGGCGCGGCCTGCAATTCCTGGTGGATCGGACTGATTTTCGACAAAACG
TCAAAATCGAGGTGCTTGATGTCTCGAAAGAAGCGCTGCGTCAAGACTTCGAAGATGCACCGGACATCAT
CCAGAGTGGCCTGTTCCGGCTGACATACGTCGGCGAATACGACATGCCGGGCGGGCAGCCCATCGCCGCG
ATCGTCTCGGCCTTTGAATTCGATCACGGCGGCCCGGACATCGCACTATTGCGCAATATCTCGAAAGTCG
CGGCCGCGGCCCATATGCCGTTCATCGGCGCCGTCTCGCCTGCGTTCTTCGGGAAAACCACGATGGAAGC
CGTCGCAGGCATCCGCGATCTGCCGAGCTGGTTCGAGCGGGCCGAATACCTGAAGTGGAAAGGCTTCCGT
GAAACTGAGGATGCACGCTACATCGCGCTCACAATGCCGCGATTCCTTGCACGTTTGCCGTACGGATTCG
ATACGATGCCCGTGCGCGCATTCAATTACACCGAGAATGTCAGGGAATCTGGTCGCAGCGCATATCTGTG
GACAAGCGCGGCGTTCGCTTTTGCGGTCAATATCGTGCGCAGCTTCGTACGAAACGGTTGGTGTGTGCAG
ATTCGCGGCCCGCAAGCGGGTGGCGTCATCAATGACATTCCCGCGCATCGGTACGACCTCGGCGCCGGGC
AACTGGGTAAGATTTCCACGGACGCATTGATTTCGGAAACACGCGAGAATGAATTCGCCGATATCGGCCT
AATTCCCCTTTCGTATACCCGCAATCACGATCAAACGTGTTTCTTCTCGGCGCATTCAACGCAACGGCCG
CGATCTTACGATGCACGCGACGCCTCCGCGAATAGCCGGATCAATGCCCGTTTACCGTACATCTTCTTGC
TGTCACGGATCGCACATTACCTGAAGCTCATCCAGCGCGAAAACATCGGCACGACGCGCGATAGCCGATT
GCTGGAGCTCGAGCTGAATACCTGGATTAAATCGCTTGTCACGGAAATGACCGATCCCGGCGATGAACTT
CAGGCGGCACACCCGCTGCGGCAGGCCAAGGTCACGGTCGAGGACATCGAGGACAACCCGGGGTTCTTCC
GCATCAAGCTGTTCATCGTCCCGCATTTTCAGATCGAGGGCGTCGACATCAACCTCTCCCTGGTTTCGCA
GATGCCGAAAGCGAAACATTGA
 Primer design