SecReT6
Protein ID: 134293127
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4432
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1258206..1261319 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4JM95
KEGG IDbvi:Bcep1808_4432
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.10E-44, Aligned region: 596..749
Phage_GPD [PF05954], Evalue: 1.80E-42, Aligned region: 51..345
T6SS_Vgr [PF13296], Evalue: 9.60E-34, Aligned region: 478..584
Phage_base_V [PF04717], Evalue: 1.20E-07, Aligned region: 376..469
Protein Sequence: 1037 a.a.     [Download]
>gi|134293127|ref|YP_001116863.1| Rhs element Vgr protein [Burkholderia vietnamiensis G4]
MSNLFDDARRFVSDLTGVSGRQAYFFEVPGTESAVALSVVSVMAVERMGYPTEVRVVLTHPLQLARTDYL
NRDAVCTIVPDDGVPHRFSGFIARFSTLQTTADFTKYEIVLKSHFARLEAVSTSRIYQHQTTPQIIEAVL
RSHGLEGHQFAFRLRREYPKHLFRFQYKLDDLSYVRMLMQKAGIYSYIVETEHGDQAVFADDVDHYQWDP
HLTAAYRETAGLEATGAEAVTALKTHTVTVPQSFVVADYNPEQAWERFKDEANVAPQDQTTYGRPYVYGT
NHLDQDGAKWEAQLRHEAAIAWQVVYEGESNVLALQPGRVLNLDAALPDAPDGQVVIEVTHSGARDRAYT
NSYKAIPANRRFRLQLEDAKWRKIAGTLSARVTSPDKYKYAYLTAAGYYTVRFDVDFADWPAGGESVPLR
LAKPFAGKLQTGFHFPALDNDEAVIAFRDADPDKPEIIGFHHHSQARDLVTSDRRWLSRNVIRTQSNNKL
RMEDWAGQEGVKLSTEHSGTSHLDLGYLVDEKLERRGEGFELRTSGHGVERAGKGLHLTAYDRPGASGKQ
LDMQETIAQLEQALALAKSLGDAARTAKAMPADTDAQQQMKDEFDGLKQPGLLASAPASIGVVAGGGVQM
AAKESISAVAGKNADFSVMKRFTAAAGEAVSLFAQKLGIKIFAAKGPVEVQAHNGPMSLVADKDLTVTSV
NGAVFVRAETELTLGSGGAFIQLKDENITVGGPLDLFLKVITIQQQGKAQMHLAAPAFSTTVVPFTFACD
AWRRPIDSDNTESTQPTPKASDWNQLGNPAAVSAEAPAPRPQKQQPNSQPAVTTKPDVPSAEAIAHDARA
KPAALPADNESAHEPKKPLADDAGTPIKLETPVVCDWHTPAFTEERTDSTETVEYYGLDSHKNAWPDAQT
LSGAQLDTAFELSYDPEKKTLYAAVRVQVIPVELFKCDGSGKPVPGEDGKLESRPFDHDKHSFLVACGVD
KPMNGYVMKYREGTGENFDINAKARQIEAVLNGHKSKLILNGCITGCGLWMPSLGCV
 
Nucleotide Sequence: 3114 bp     [Download]
>gi|134292031|ref|NC_009255.1|:1258206-1261319 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTCGAACCTGTTTGACGATGCGAGGCGGTTCGTATCGGACTTGACCGGGGTGTCGGGGCGCCAGGCAT
ATTTCTTCGAGGTGCCGGGGACCGAGAGCGCAGTTGCACTCTCGGTCGTGTCGGTGATGGCGGTCGAGCG
GATGGGATATCCCACCGAGGTGCGAGTGGTGCTCACGCATCCGCTGCAGCTGGCCCGCACTGACTATCTG
AATCGCGACGCGGTCTGCACGATCGTGCCTGACGATGGTGTGCCACATCGTTTCTCCGGTTTTATCGCGC
GCTTCTCGACGCTGCAGACCACCGCGGACTTCACCAAGTACGAGATCGTGCTGAAGTCGCACTTCGCGCG
ACTGGAAGCGGTGAGCACCAGCCGTATCTACCAGCACCAGACGACGCCGCAGATCATTGAGGCAGTGCTG
CGCAGCCATGGCTTGGAAGGCCACCAGTTCGCATTCCGGCTGCGCCGCGAGTATCCGAAGCACCTGTTCC
GCTTCCAGTACAAGCTCGACGACCTGTCGTATGTGCGGATGCTGATGCAGAAGGCCGGCATCTACAGCTA
CATCGTCGAGACCGAGCATGGCGATCAGGCGGTGTTTGCCGACGACGTCGACCATTACCAGTGGGACCCG
CACTTGACTGCGGCGTATCGCGAGACTGCGGGGCTGGAGGCGACCGGCGCCGAGGCGGTGACCGCACTCA
AGACGCATACGGTGACCGTGCCGCAGTCGTTTGTCGTGGCCGATTACAACCCCGAGCAGGCGTGGGAGCG
GTTCAAAGACGAGGCGAACGTCGCGCCGCAGGACCAGACTACCTATGGGCGGCCGTACGTCTACGGTACG
AATCACCTCGATCAGGACGGCGCGAAATGGGAGGCGCAACTGCGCCATGAAGCGGCGATCGCGTGGCAGG
TGGTGTACGAAGGTGAGAGCAACGTACTGGCACTTCAGCCGGGGCGCGTGCTGAATCTGGACGCCGCACT
GCCTGACGCGCCGGACGGTCAAGTCGTGATCGAGGTGACGCATAGCGGCGCGCGCGATCGGGCCTATACG
AACAGCTATAAGGCGATTCCCGCTAACCGGCGCTTCCGGCTCCAGCTCGAAGACGCGAAGTGGCGGAAGA
TTGCCGGGACGCTGAGCGCTCGGGTGACGAGCCCCGACAAGTACAAATACGCTTACCTGACCGCGGCGGG
CTACTACACGGTCCGATTCGACGTGGACTTCGCGGACTGGCCGGCAGGCGGGGAAAGCGTGCCGCTGCGG
CTGGCAAAGCCCTTCGCGGGCAAGTTGCAGACGGGCTTCCACTTCCCGGCGCTGGACAACGATGAAGCGG
TGATCGCGTTCCGGGACGCGGACCCCGACAAGCCGGAGATCATCGGCTTCCACCATCACAGTCAGGCGCG
CGATCTGGTGACGAGCGATCGCCGCTGGCTGTCGCGCAACGTGATTCGCACGCAGTCGAACAACAAACTG
CGGATGGAGGACTGGGCGGGGCAGGAGGGCGTCAAGCTCAGCACTGAGCATTCGGGTACGAGCCATCTCG
ATCTTGGCTATCTGGTCGACGAGAAACTGGAGCGGCGCGGTGAGGGTTTCGAACTGCGCACGTCGGGTCA
CGGTGTCGAGCGCGCGGGCAAGGGGCTGCATCTGACGGCCTACGACCGCCCGGGTGCGAGCGGGAAGCAA
CTCGACATGCAGGAGACGATCGCGCAACTGGAGCAGGCGCTGGCGTTGGCGAAGTCGCTGGGCGACGCGG
CGCGTACGGCCAAGGCGATGCCGGCCGACACGGATGCGCAACAGCAGATGAAGGACGAGTTCGACGGGCT
GAAGCAGCCGGGCTTACTGGCGAGTGCGCCGGCCTCGATCGGCGTCGTGGCAGGCGGCGGCGTGCAGATG
GCTGCGAAGGAGAGTATCTCGGCGGTGGCTGGCAAGAACGCTGACTTCAGCGTGATGAAGCGTTTCACGG
CGGCCGCGGGCGAGGCGGTCTCGTTGTTCGCGCAGAAGCTTGGAATCAAGATCTTTGCGGCTAAGGGGCC
GGTCGAAGTACAAGCCCATAATGGACCAATGTCATTGGTAGCAGACAAAGACTTGACCGTGACAAGTGTC
AACGGCGCTGTTTTCGTTCGAGCCGAAACTGAACTGACGCTTGGTAGTGGCGGCGCATTCATTCAGCTCA
AGGACGAAAATATTACCGTGGGCGGTCCGCTCGATTTGTTCCTGAAGGTCATCACGATTCAGCAGCAAGG
CAAGGCACAGATGCACCTGGCGGCACCGGCGTTTTCGACAACCGTAGTGCCGTTTACGTTCGCCTGCGAC
GCGTGGCGTCGTCCGATCGATTCGGATAACACGGAATCAACGCAGCCAACGCCAAAGGCTTCCGACTGGA
ATCAACTCGGCAATCCCGCGGCTGTAAGCGCCGAAGCTCCGGCGCCGCGCCCGCAAAAGCAACAACCAAA
CTCGCAGCCCGCTGTCACTACGAAACCTGATGTACCGAGTGCGGAGGCAATAGCACACGACGCGCGGGCG
AAACCTGCTGCGTTACCTGCTGACAACGAATCGGCGCATGAACCGAAAAAGCCGCTGGCGGATGATGCCG
GCACGCCTATTAAGCTGGAGACACCCGTCGTATGCGACTGGCACACGCCAGCGTTCACAGAAGAGCGCAC
AGATTCGACCGAAACAGTAGAGTACTACGGCTTGGATAGCCACAAGAATGCATGGCCCGACGCCCAAACG
TTATCCGGGGCACAGCTAGACACGGCATTTGAGTTGTCATATGACCCTGAGAAAAAGACGCTTTATGCAG
CGGTGCGCGTGCAGGTCATTCCTGTTGAATTGTTCAAATGCGATGGCTCTGGGAAGCCTGTGCCAGGCGA
AGATGGCAAGCTTGAATCCCGCCCGTTTGATCACGACAAACATTCATTCCTTGTGGCGTGTGGAGTAGAC
AAGCCGATGAACGGCTATGTTATGAAATATCGCGAGGGGACTGGGGAGAATTTTGACATCAATGCCAAAG
CTCGTCAGATTGAGGCTGTTCTCAATGGGCATAAGAGCAAACTGATTTTAAATGGATGCATCACGGGATG
CGGCTTGTGGATGCCGAGTCTCGGTTGTGTTTAA
 Primer design