SecReT6
Protein ID: 134293130
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4435
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1263820..1266366 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4JM98
KEGG IDbvi:Bcep1808_4435
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 7.50E-49, Aligned region: 596..750
Phage_GPD [PF05954], Evalue: 5.80E-45, Aligned region: 63..344
T6SS_Vgr [PF13296], Evalue: 7.30E-34, Aligned region: 478..584
Phage_base_V [PF04717], Evalue: 6.40E-09, Aligned region: 376..469
Sarcoglycan_1 [PF04790], Evalue: 0.0022, Aligned region: 669..714
Protein Sequence: 848 a.a.     [Download]
>gi|134293130|ref|YP_001116866.1| Rhs element Vgr protein [Burkholderia vietnamiensis G4]
MSSLFDDAKRFVSNLTGVPGRQAYFFEVPGTDSAAALSVVSVKAVERMGAPTEVRAVLTHPLQLARTDYL
NRDAACTIVSDDGVPRRFSGFIERFSTLQTTADFTKYEIVLKSHFARLEAVSTSRIYQHQTTPQIIEAVL
RSHGLEGHQFAFRLRREYPKHLFRFQYKLDDLSYVQMLMQKAGIYSYIVETEHGDQVVFADDIDHYLWDP
HLTVPYREVAGLEATGTEAVTALRTHAVVVPQSFVVADYNPEQAWERFRDDANVAPQDPTTYGQTYVYGT
HHLDQAGAKWEAQLRHEAAIAWQVVYEGESNVLALQAGRVLNLDTVLPDASDGQVVIEVTHRGARDRAYS
NSYTAIPANRRFRLKLEEAKWPKIAGTLSARVTSPDKYKYAYLTAAGYYTVRFDVDFADWPAGGESVPLR
LAKPFAGKLQTGFHFPALDNDEVVIAFRDADPDKPEIIGFHHHSQARDLVTSDRRWLSRNVIRTQSNNKL
RMEDWAGQEGVKLSTEHSGTSHLDLGYLVDEKLERRGEGFELRTSGHGVERAGKGLHLTAYDRPGASGKQ
LDMQETIAQLEQALALAKSLGDAARTAKAMPADTDAQQQMKDEFDGLKQPGLLASAPASIGVVAGGGVQM
AAKESISAVAGKNADFSVMKRFTAAAGEAVSLFAQKLGIKIFAAKGPVELQAQSNAMALTAEKDVSIASA
NGKVNLSAAKELILECGGAFIKIADGNITLGGPGDLFLKVLTIQKQGAQSLNLPVPQLPVPAGVEMFSQR
LDVSPLLGKEFSLPLHHIPYAVKDSTGRIVDSGMLDEAGYTGRTFTKQSSKLKYHIGNDPWRLFLDSKHA
EIDNEPQE
 
Nucleotide Sequence: 2547 bp     [Download]
>gi|134292031|ref|NC_009255.1|:1263820-1266366 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTCGAGCCTGTTTGATGACGCGAAGCGGTTCGTGTCGAACCTGACCGGCGTGCCGGGGCGTCAGGCGT
ATTTCTTCGAAGTGCCGGGCACGGACTCGGCGGCCGCGCTGTCCGTGGTGTCGGTGAAGGCCGTCGAGCG
GATGGGTGCGCCGACCGAGGTGCGCGCCGTGCTCACGCATCCGCTGCAACTCGCACGCACTGACTACCTG
AACCGCGACGCGGCTTGCACGATCGTTTCCGACGACGGGGTGCCGCGCAGATTCTCTGGCTTCATCGAAC
GCTTCTCGACGCTGCAGACCACGGCTGACTTCACCAAGTACGAGATCGTACTGAAGTCGCACTTCGCGCG
ACTGGAAGCGGTGAGCACCAGCCGCATCTACCAGCACCAGACGACGCCGCAGATCATCGAGGCAGTGCTG
CGCAGCCATGGCTTGGAAGGCCACCAGTTCGCATTCCGGCTGCGCCGCGAGTATCCGAAGCACCTGTTCC
GCTTCCAGTACAAGCTCGACGACCTGTCGTATGTGCAGATGCTGATGCAGAAGGCCGGTATCTACAGCTA
CATCGTCGAGACCGAGCATGGCGATCAGGTCGTGTTCGCCGACGACATTGATCATTACCTGTGGGACCCG
CACCTCACGGTTCCGTACCGCGAGGTGGCCGGGCTCGAAGCGACCGGTACGGAGGCTGTGACGGCGCTTA
GAACTCACGCGGTTGTCGTCCCGCAGTCGTTTGTCGTGGCCGACTACAACCCCGAGCAGGCGTGGGAGCG
TTTCCGGGACGACGCAAACGTTGCACCGCAGGATCCGACCACGTACGGCCAGACCTACGTCTACGGCACT
CACCATCTCGATCAGGCGGGCGCGAAGTGGGAGGCGCAACTGCGCCATGAAGCGGCGATCGCATGGCAGG
TCGTGTACGAAGGTGAGAGCAACGTGCTGGCGCTGCAGGCCGGGCGCGTGCTGAATCTCGACACGGTATT
GCCCGATGCATCCGACGGACAGGTGGTGATCGAAGTGACGCATCGCGGCGCGCGCGATCGGGCTTACTCG
AACAGCTACACCGCAATTCCCGCTAATCGGCGCTTCCGGCTCAAACTCGAAGAAGCGAAGTGGCCGAAGA
TTGCCGGGACGCTGAGCGCTCGGGTGACGAGCCCCGACAAGTACAAATACGCTTACCTGACCGCGGCAGG
CTACTACACGGTCCGGTTCGACGTGGACTTCGCGGACTGGCCGGCGGGCGGGGAAAGCGTGCCGCTGCGG
CTCGCCAAGCCGTTCGCAGGCAAGCTGCAGACGGGTTTCCATTTCCCGGCGCTGGACAACGACGAAGTGG
TGATCGCGTTCCGGGACGCGGACCCCGACAAGCCGGAGATCATCGGCTTCCATCATCACAGTCAGGCGCG
CGATCTGGTGACGAGCGATCGACGCTGGCTGTCGCGCAACGTGATCCGCACGCAGTCGAACAACAAACTG
CGGATGGAGGACTGGGCGGGGCAGGAGGGCGTCAAGCTTAGCACGGAACACTCCGGCACGAGCCACCTGG
ACCTGGGCTATCTGGTCGACGAGAAACTGGAGCGGCGCGGTGAGGGTTTCGAACTGCGCACGTCGGGTCA
CGGTGTCGAGCGCGCGGGCAAGGGGCTGCATCTGACGGCCTACGACCGCCCGGGTGCGAGCGGGAAGCAA
CTCGACATGCAGGAGACGATCGCGCAACTGGAGCAGGCGCTGGCGTTGGCGAAGTCGCTGGGCGACGCGG
CGCGTACGGCCAAGGCGATGCCGGCCGACACGGATGCGCAACAGCAGATGAAGGACGAGTTCGACGGGCT
GAAGCAGCCGGGCTTACTGGCGAGTGCGCCGGCCTCGATCGGCGTCGTGGCAGGCGGCGGCGTGCAGATG
GCTGCGAAGGAGAGTATCTCGGCGGTGGCTGGCAAGAACGCTGACTTCAGCGTGATGAAGCGTTTCACGG
CGGCCGCGGGCGAGGCGGTCTCGTTGTTCGCGCAGAAGCTTGGAATCAAGATCTTTGCGGCTAAGGGGCC
AGTCGAGTTGCAGGCGCAGAGCAACGCCATGGCACTCACGGCAGAGAAGGATGTAAGCATCGCCAGTGCG
AACGGAAAGGTGAATCTCTCCGCCGCGAAAGAACTCATTCTCGAGTGTGGCGGGGCGTTCATCAAGATCG
CGGACGGCAATATCACACTGGGCGGCCCGGGCGACCTATTCCTGAAAGTACTCACCATTCAGAAGCAGGG
AGCGCAGTCTCTGAATCTGCCGGTTCCGCAATTGCCCGTCCCCGCTGGCGTTGAAATGTTCAGCCAACGG
CTCGATGTCAGTCCGCTGCTCGGCAAGGAATTCTCGCTTCCCTTGCACCATATTCCGTATGCGGTGAAAG
ACTCAACCGGGCGGATCGTTGATAGCGGCATGCTCGACGAAGCAGGGTATACGGGGCGTACGTTCACCAA
ACAGTCTTCAAAGCTGAAGTACCACATCGGCAACGATCCTTGGCGTCTGTTTCTCGACTCGAAGCACGCC
GAGATCGACAACGAGCCTCAGGAATAG
 Primer design