SecReT6
Protein ID: 134293136
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4441
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1271735..1275289 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4JMA4
KEGG IDbvi:Bcep1808_4441
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.90E-72, Aligned region: 409..727
DUF1215 [PF06744], Evalue: 1.60E-36, Aligned region: 850..975
Protein Sequence: 1184 a.a.     [Download]
>gi|134293136|ref|YP_001116872.1| ImcF domain-containing protein [Burkholderia vietnamiensis G4]
MTLKRRILGRCLLVIAAIAAVTALILYTVDLKDLKAWSSQNRLAIVGAGVMLLAAIGVTLQRRGLVQLGA
QQASKDHGLEPPPPINPAADAGKKQVESAALQLKDLRFQMKQIRWFRWAYTRPWLLLTGDETTIGRLLPD
LKERGWLLADDAVLLWGRTGSDGRPDEMWLKQIRRFRRTRPLDAIILMVDESTLLPDAVRGTTSPWGIHL
ARITHLLRWSAPVFVLDLDGTDTVHRVDTPVTGCEIPHAADAPAIETALLELRNRLADVSVGQLAHNPAD
RYASDLSTRLDTRSAPLARWIASLSDWQRRAQPVAGVMFAPWPASGATTTGTDSLHFPLWRYLTDAAKRT
PGRRTATHPLTMVSGIALAAVGLWGAGMLISGLTNARGLALTNDVLRTFNGANSPATRLRALLALQQRIE
FYEARVERPTLFSRFGLNHDQDVLTALWKPYVREARPQLLAPVQQDIEGQLVDLTQMPTAQVDDQVNRLA
RDGHATLKTYLMMADPSRADAAFMTPQLVRHWNGGIGLSPGEKLDLSQRLLAFYAQHLGAHPDWRIAARD
ELVAGARQTLLAVIGVKNSEDMIYQGILESVGRKYPDQTLASLTDGTDTRGLLKTTASVPGAYTRQAWDG
TIEAAIDDMAKRNGVTADWVLGATSANRNASAATPEALRASLRTRYFADYADRWQTFMNSITCEPARTLP
AAVAQLKLIADSRQSPVISLMKSLEFQGGAGVVKTSLSDTLVNKAQNMFASKDNAPQPAAPDPAGPLGVS
FGPVLHLIAPGNAATAGATSDLSLQRFIERITMLRLKLQQIADSPDADSESRQVAQSLFQGKSSELADTL
AYAQLVAASLGEQWAGMGQSLFVQPVTQATQAILEPAQASLNDAWRQTVVASWNRSFAGRYPFANTNNDA
SLPELSRFLRPQGGLVGVFLATQLAGVLTLQGDQWVPASSGSGASSAARTIDPAFLNAINMLQRIANHLL
AQGEPQYAFDLKPVPSLGVTDTRLTVDGQKLHYYNQQETWQTFTWPSNEPQKAGTRLEWQTERAGTNLNM
EFGGRWALVRLLERAHVSPVDTATYLITWQAAPQSKAGVAKTDDGESLTTQAPLAPAPASLAYPLTYLMR
TDVGKGPLELLALRGFALPSRVFVPRTTPSRAAGTALQPPPLPPGALAAARHASVPIPGGSLPE
 
Nucleotide Sequence: 3555 bp     [Download]
>gi|134292031|ref|NC_009255.1|:1271735-1275289 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
GTGACGTTGAAAAGACGCATATTGGGCCGGTGCCTGCTCGTCATCGCGGCGATCGCGGCCGTGACGGCGT
TGATTCTGTACACCGTCGATCTCAAGGATCTGAAGGCGTGGTCCTCCCAAAATCGGCTAGCTATCGTCGG
CGCTGGAGTGATGCTGTTGGCAGCGATCGGTGTCACTTTGCAGCGACGCGGGCTCGTGCAGCTCGGTGCG
CAGCAGGCGTCCAAAGATCATGGGCTCGAGCCTCCTCCTCCGATCAACCCCGCTGCCGACGCCGGGAAGA
AGCAGGTTGAATCGGCCGCCTTGCAGTTGAAGGACCTCCGCTTCCAGATGAAGCAAATCCGATGGTTTCG
ATGGGCTTATACGCGCCCCTGGCTGCTGTTGACGGGCGACGAGACAACTATTGGCCGCCTGTTGCCCGAC
CTCAAAGAACGCGGCTGGCTGCTCGCGGATGACGCGGTGCTGCTGTGGGGGCGCACCGGATCGGACGGTC
GGCCCGACGAGATGTGGCTGAAGCAGATCCGTCGCTTTCGTCGCACGCGTCCGCTCGACGCGATCATCCT
GATGGTCGACGAATCGACATTGCTGCCCGACGCAGTTCGCGGCACGACAAGTCCATGGGGCATCCACCTC
GCGCGTATCACGCACCTGCTGCGTTGGTCTGCGCCGGTATTCGTCCTCGATCTCGACGGCACCGACACCG
TTCACCGTGTGGATACGCCCGTCACCGGTTGTGAAATCCCGCACGCTGCTGATGCGCCTGCAATCGAAAC
CGCGCTACTCGAATTACGCAATCGATTGGCCGACGTCAGTGTCGGCCAGCTCGCGCACAACCCTGCCGAC
CGCTACGCGTCAGATCTCTCGACCCGTCTCGATACGCGTAGCGCACCGCTGGCTCGCTGGATCGCGAGTT
TGTCCGACTGGCAACGTCGTGCCCAACCGGTTGCCGGTGTGATGTTCGCACCGTGGCCGGCATCCGGAGC
GACGACAACGGGCACCGACAGTCTTCACTTTCCGTTGTGGCGCTATCTGACCGATGCAGCCAAGCGTACG
CCGGGCCGCCGTACGGCGACGCATCCTCTCACGATGGTCTCGGGAATCGCGCTGGCGGCCGTCGGACTGT
GGGGCGCCGGCATGCTCATCTCGGGCCTGACGAATGCCCGCGGCCTGGCGCTGACGAATGACGTGCTTCG
CACGTTCAATGGCGCCAACAGTCCGGCGACCCGTCTGCGCGCCTTGCTCGCGCTCCAGCAGCGCATCGAG
TTCTACGAAGCGCGCGTCGAGCGTCCGACGCTGTTCTCGCGCTTCGGCCTGAATCACGATCAGGACGTGC
TCACCGCGTTATGGAAGCCCTATGTGCGCGAAGCGCGCCCGCAACTGCTTGCGCCCGTGCAACAGGACAT
CGAAGGGCAACTGGTCGATCTCACGCAGATGCCGACCGCCCAAGTCGATGACCAGGTCAATCGCCTCGCT
CGCGACGGTCACGCCACGCTCAAGACGTACCTGATGATGGCGGACCCGTCGCGCGCCGATGCGGCGTTCA
TGACGCCGCAACTGGTGCGCCATTGGAACGGCGGCATCGGACTGTCTCCGGGCGAAAAGCTCGACCTGTC
GCAGCGGCTGCTGGCGTTCTACGCGCAGCACCTCGGCGCGCATCCCGACTGGCGCATCGCCGCGCGTGAC
GAGCTCGTCGCGGGCGCCCGCCAGACCTTGCTCGCCGTGATCGGCGTGAAAAACTCGGAAGACATGATCT
ATCAGGGCATCCTCGAATCGGTCGGTCGCAAGTACCCGGACCAGACGCTCGCGTCTCTGACCGATGGCAC
CGACACGCGCGGACTGCTGAAAACCACGGCCAGCGTGCCCGGCGCGTACACGCGTCAGGCATGGGACGGG
ACCATCGAGGCCGCGATCGACGACATGGCGAAACGCAATGGCGTGACGGCCGACTGGGTGCTCGGCGCGA
CCAGCGCCAATCGCAACGCGTCGGCCGCGACGCCCGAGGCGCTGCGCGCGTCGTTGCGCACGCGCTACTT
CGCGGACTATGCGGACCGTTGGCAAACCTTCATGAACAGCATCACGTGCGAACCGGCGCGGACCTTGCCG
GCCGCCGTCGCGCAGTTGAAACTCATCGCCGATTCGCGGCAGTCGCCGGTGATCTCGCTGATGAAGTCGC
TCGAGTTCCAGGGCGGAGCGGGCGTCGTGAAGACATCGCTGTCCGACACCCTGGTGAACAAGGCGCAGAA
CATGTTCGCGAGCAAGGACAATGCGCCGCAGCCGGCCGCGCCCGACCCGGCCGGACCGCTCGGCGTGTCG
TTCGGCCCCGTGTTGCATCTGATCGCACCGGGGAACGCTGCGACGGCAGGCGCAACGAGCGACCTGAGCC
TGCAGCGTTTCATCGAACGCATCACGATGCTGCGTCTGAAGCTGCAACAAATCGCTGACAGCCCGGACGC
CGATAGCGAGTCGCGACAAGTCGCGCAGTCGCTGTTCCAAGGCAAGAGTTCGGAACTGGCCGACACGCTC
GCCTATGCGCAGCTTGTCGCCGCCAGTCTCGGCGAGCAGTGGGCGGGGATGGGGCAGTCGCTGTTCGTGC
AGCCGGTCACGCAAGCCACTCAGGCCATTCTGGAGCCGGCACAGGCGAGCTTGAACGACGCATGGCGCCA
GACCGTCGTCGCGAGCTGGAACCGCTCGTTTGCCGGCCGCTATCCGTTCGCCAACACCAACAACGACGCA
TCGTTGCCGGAGCTGTCGCGCTTCCTGCGACCGCAGGGCGGCTTGGTCGGCGTGTTCCTCGCCACGCAGC
TGGCGGGCGTGCTGACGTTGCAGGGCGACCAATGGGTGCCGGCATCGAGCGGTTCGGGCGCGAGCAGCGC
GGCGCGCACGATCGATCCGGCCTTTCTCAATGCGATCAACATGCTGCAGCGGATCGCCAATCACCTGCTG
GCGCAGGGCGAGCCGCAGTACGCATTCGACCTCAAACCGGTACCCAGCCTCGGCGTGACGGACACGCGCC
TAACGGTAGACGGTCAAAAGCTGCACTACTACAACCAGCAGGAGACGTGGCAGACGTTCACGTGGCCGTC
GAACGAGCCGCAGAAGGCGGGCACGCGTCTCGAATGGCAGACCGAGCGAGCGGGCACGAACCTGAACATG
GAATTCGGCGGCCGGTGGGCGCTGGTCCGGCTGCTGGAGCGAGCACACGTGAGCCCGGTGGATACGGCCA
CCTATCTGATCACTTGGCAGGCCGCGCCGCAGTCGAAGGCAGGCGTCGCGAAGACGGACGATGGCGAGTC
GTTGACCACGCAGGCGCCGCTCGCTCCCGCGCCGGCATCGCTGGCGTATCCGCTCACCTACCTGATGCGC
ACCGATGTGGGCAAGGGGCCGCTCGAACTGCTGGCGTTGCGCGGGTTCGCATTGCCTTCACGCGTCTTTG
TGCCCCGAACGACGCCGTCCCGAGCGGCCGGTACGGCGTTGCAGCCGCCGCCGCTTCCGCCGGGCGCACT
CGCCGCGGCGCGCCACGCATCCGTGCCGATCCCCGGCGGGTCTCTGCCCGAATGA
 Primer design