SecReT6
Protein ID: 134293137
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4442
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1275306..1277120 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4JMA5
KEGG IDbvi:Bcep1808_4442
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-181, Aligned region: 11..602
Protein Sequence: 604 a.a.     [Download]
>gi|134293137|ref|YP_001116873.1| hypothetical protein Bcep1808_4442 [Burkholderia vietnamiensis G4]
MTNPIKDNEILRYYEAEMRYLRDAGREFADAFPDRARELGLDRGGERDPHVERLLEGFAFLMGRLRHKLD
DELPELTEGLVSMLWPHYLRMIPSLSILELTPDMGALQKHETLGAGLEVTSGPIATGHTDGAPAHVECVY
RTTQPIDLYPITLTDAGAWAREDGRSVIRLRLAIQPQAQRERLHVPRLRLYLDADRPIALALHAALTAKP
LAMHVRVPGFPEDRPGAPQDIPGLRIEAAGYAGNERLWPKADNAFGGYQLLLEYFTFPEKFMFVDLLGLD
IQALPPSAPHVDVEIVLAKPWQDDMRFNAQNVRLYCTPIINLFPVQADPVKVTQFETEYRVRAREQHGPL
VDIYSIDAVHGIDRGRRFEYAPFAAFRHRGGMLRHTMPERYFHSHVRRAPSGRFDTWVVLGGHAWESEHA
LPAETLSLSVTGTNGMLPRKALRDASITRMRAGFTNIAAVRNLTAPTLPVYPPTGDRFQWRVLSHLAPNY
LSLLDAEILRGSLALYDWTDGELNRRRIEAITDVRHRPLQKLVKGGLMRGVEIAVTIDSTRFAGNGDLEL
FGAMLNRFLGLYATVNLYTKLVIVSQPTGQRLEWPDTKGEGAPF
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|134292031|ref|NC_009255.1|:1275306-1277120 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGACGAATCCGATCAAGGATAACGAGATCCTGCGCTATTACGAGGCGGAGATGCGCTATTTGCGCGACG
CCGGCCGGGAGTTTGCCGATGCATTTCCCGATCGCGCGCGCGAGCTGGGCCTGGATCGCGGAGGCGAGCG
CGACCCTCATGTGGAACGGCTGCTCGAAGGCTTCGCGTTCCTGATGGGCCGCCTGCGTCACAAGCTCGAC
GACGAGCTGCCCGAGCTGACCGAAGGGCTCGTCAGCATGCTGTGGCCGCACTATCTGCGCATGATTCCGT
CGCTGTCGATCCTCGAGCTCACGCCGGACATGGGTGCGCTGCAAAAGCACGAGACGCTCGGCGCCGGCCT
CGAGGTGACGTCCGGACCGATCGCGACGGGCCACACAGACGGCGCACCCGCACACGTCGAATGCGTGTAC
CGCACGACGCAGCCGATCGATCTCTACCCGATCACGCTCACCGACGCAGGCGCGTGGGCGCGCGAAGACG
GTCGCTCGGTCATCCGGTTGCGCCTGGCGATTCAGCCACAAGCTCAGCGTGAACGACTGCATGTACCGCG
ACTGCGGCTGTATCTCGACGCGGACCGGCCGATTGCGCTCGCACTGCATGCCGCGTTGACGGCGAAACCG
CTGGCAATGCACGTGCGTGTGCCCGGTTTCCCGGAAGATCGCCCCGGTGCGCCTCAAGATATACCGGGGC
TTCGGATCGAGGCGGCCGGCTACGCGGGCAACGAACGTCTGTGGCCGAAGGCCGACAACGCGTTCGGCGG
CTACCAATTGCTGCTGGAGTACTTCACGTTCCCCGAGAAGTTCATGTTCGTCGACCTGCTCGGGCTCGAC
ATCCAGGCGCTTCCACCGTCCGCGCCGCATGTCGACGTCGAGATCGTGCTGGCAAAGCCGTGGCAGGACG
ACATGCGTTTCAACGCGCAGAACGTGCGGCTCTACTGCACGCCGATCATCAACCTGTTTCCCGTTCAGGC
CGATCCGGTCAAGGTCACTCAGTTCGAGACCGAGTACCGGGTACGGGCGCGCGAGCAGCACGGCCCGTTG
GTCGATATCTACTCGATCGACGCGGTGCACGGCATCGATCGCGGCCGACGCTTCGAATATGCGCCGTTCG
CGGCATTCCGCCATCGTGGCGGCATGCTGCGCCATACGATGCCCGAGCGATATTTCCATTCGCACGTGCG
ACGCGCGCCTTCCGGACGGTTCGATACGTGGGTCGTGCTGGGCGGCCACGCTTGGGAAAGCGAGCATGCG
CTGCCCGCGGAAACGCTGTCGCTGTCGGTGACGGGCACCAACGGCATGCTGCCGCGCAAGGCGCTGCGCG
ATGCCAGCATCACGCGGATGCGCGCGGGCTTCACCAACATCGCGGCAGTGCGCAATCTGACCGCACCGAC
GCTGCCGGTCTACCCGCCGACCGGCGATCGCTTCCAATGGCGTGTGCTGTCCCATCTGGCGCCGAACTAT
CTGTCGCTGCTCGATGCGGAAATCCTGCGCGGCTCGCTCGCGTTGTACGACTGGACGGACGGGGAGTTGA
ACCGGCGTCGCATCGAGGCGATCACCGACGTGCGTCACCGGCCATTGCAGAAGCTCGTGAAGGGCGGCCT
GATGCGCGGCGTCGAGATTGCGGTGACGATCGACAGCACACGTTTCGCGGGCAACGGCGATCTCGAGCTG
TTCGGCGCCATGCTGAACCGGTTCCTCGGCCTCTATGCGACGGTCAACCTGTACACGAAGCTCGTCATCG
TGTCGCAGCCGACCGGTCAGCGGCTCGAATGGCCCGATACGAAGGGCGAAGGAGCGCCGTTTTGA
 Primer design