SecReT6
Protein ID: 134293139
SecReT6 ID196
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_4444
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]1278246..1278896 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA4JMA7
KEGG IDbvi:Bcep1808_4444
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-40, Aligned region: 27..176
Protein Sequence: 216 a.a.     [Download]
>gi|134293139|ref|YP_001116875.1| hypothetical protein Bcep1808_4444 [Burkholderia vietnamiensis G4]
MDNNQMNILRIPIGRSLAGAVATVVVVATAGCGVGQAVKDSTVDAAKWAFTTQVKTMNLDLVARSSLNAN
AAGQPLSTVVRLYQLKDAKTFEQLDYTQLQTNDLEALKADLLATKDVVLRPGASASVVEPMNPDAQVVGV
VAFFHEPGDGAVWKLAVPKKQWKKTDPVKIEVRDNTLNLVGTKDRPITHTAPQQSAPAAPKPIPKATTQS
GTQDEG
 
Nucleotide Sequence: 651 bp     [Download]
>gi|134292031|ref|NC_009255.1|:1278246-1278896 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGGACAACAATCAGATGAACATTTTAAGGATACCGATTGGACGAAGCCTGGCCGGTGCAGTGGCCACCG
TGGTGGTCGTTGCGACCGCCGGTTGCGGCGTCGGCCAGGCCGTGAAGGACAGCACGGTGGACGCTGCGAA
ATGGGCCTTCACGACGCAGGTGAAGACGATGAACCTGGACCTCGTCGCCCGCTCATCGCTCAACGCCAAC
GCGGCCGGGCAGCCGTTGTCGACGGTGGTGAGGCTCTATCAGTTGAAGGACGCGAAGACCTTCGAGCAAC
TCGACTATACCCAGTTGCAGACCAACGATCTCGAGGCGCTGAAGGCGGATCTGCTCGCGACCAAGGACGT
CGTGCTGCGCCCGGGCGCGAGCGCCAGCGTGGTCGAGCCGATGAACCCGGACGCACAGGTGGTCGGCGTC
GTGGCGTTCTTCCATGAGCCGGGGGACGGCGCGGTGTGGAAACTGGCGGTGCCGAAGAAGCAGTGGAAAA
AGACCGATCCGGTGAAGATCGAGGTGCGCGACAACACGCTCAATCTGGTCGGTACAAAGGATCGGCCGAT
AACTCACACCGCGCCCCAGCAGAGCGCACCGGCCGCGCCCAAGCCCATACCTAAAGCAACCACTCAATCC
GGCACACAGGATGAAGGATGA
 Primer design