SecReT6
Protein ID: 134293819
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5139
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2047201..2050728 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4JP87
KEGG IDbvi:Bcep1808_5139
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.50E-72, Aligned region: 400..718
DUF1215 [PF06744], Evalue: 1.40E-36, Aligned region: 841..966
Protein Sequence: 1175 a.a.     [Download]
>gi|134293819|ref|YP_001117555.1| ImcF domain-containing protein [Burkholderia vietnamiensis G4]
MDRKFWLELLFVALATALAALGIWLLVELGGINTADAERLAWLVLLAVALLVLVGVIVSWRMRHRSADGR
LAGWPGVRQADSLVEATDKNTRALADLSQVLRSRYGLRWRYRLPWFLVAGDAATIGRFSPELNEQGWLLA
DDAVLLCAQIKADGRVDDMWLTQIRRHRTARPIDAIVLVLDESTILPDSVRGTSSPWGLHLARISNLLRW
AAPVFVLDLAGSDAVHRADTPVNGCELSRASDASAVETALLELRNRLADVSVGQLAHNPADRYASDLSIR
LDTRSAPLARWLASLSDWQRRAQPVAGVMFAPWPASGATTTGTDSLHFPLWRYLTDAARRTPGRRTATHP
FTMVSGIALAAVGLWGAGMLISGLTNARGLALTNDVLRTFNGANSPATRLRALLALQQRIEFYEARVERP
TLFSRFGLNHDQDVLTALWKPYVREARPQLLAPVQQDIEGQLVDLTQMPTAQVDDQVNRLARDGHATLKT
YLMMADPSRADAAFMTPQLVRHWNGGIGLSPGEKLDLSQRLLAFYAQHLGAHPDWRIAARDELVAGARQT
LLAVIGVKNSEDMIYQGILESVGRKYPDQTLASLTDGTDTRGLLKTTASVPGAYTRQAWDGTIEAAIDDM
AKRNGVTADWVLGATSANRNASAATPEALRASLRTRYFADYADRWQTFMNSITCEPARTLPAAVAQLKLI
ADSRQSPVISLMKSLEFQGGAGVVKTSLSDTLVNKAQNMFASKDNAPQPAAPDPAGPLGVSFGPVLHLIA
PGNAATAGATSDLSLQRFIERITMLRLKLQQIADSPDADSESRQVAQSLFQGKSSELADTLAYAQLVAAS
LGEQWAGMGQSLFVQPVTQATQAILEPAQASLNDAWRQTVVASWNRSFAGRYPFANTNNDASLPELSRFL
RPQGGLVGVFLATQLAGVLTLQGDQWVPASSGSGASSAARTIDPAFLNAINMLQRIANHLLAQGEPQYAF
DLKPVPSLGVTDTRLTVDGQKLHYYNQQETWQTFTWPSNEPQKAGTRLEWQTERAGTNLNMEFGGRWALV
RLLERAHVSPVDTATYLITWQAAPQSKAGAAKTDDGESLTAQAPLAPAPASLAYPLTYLMRTDVGKGPLE
LLALRGFALPSRVFVPRTTPSRAAGTALQPPPLPPGALAAARHASVPIPGGALPE
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c2050728-2047201 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGGACCGCAAATTCTGGCTTGAACTCCTTTTTGTGGCGCTAGCGACCGCACTTGCAGCTCTGGGCATAT
GGCTCCTCGTGGAACTGGGCGGGATCAATACCGCTGATGCCGAGCGACTTGCGTGGTTGGTGCTGCTGGC
CGTTGCGCTTCTGGTGCTCGTCGGTGTAATCGTGAGCTGGCGTATGCGCCATCGTTCCGCAGACGGCCGA
CTTGCGGGCTGGCCCGGTGTACGGCAAGCCGATTCTTTGGTCGAGGCCACCGACAAAAACACTCGCGCTC
TGGCAGACCTGTCCCAGGTTTTGCGTTCGCGTTACGGCTTGCGCTGGCGCTATCGTTTGCCGTGGTTCCT
CGTTGCTGGCGACGCCGCGACCATCGGGCGGTTTTCGCCCGAACTCAACGAGCAGGGATGGCTCCTTGCC
GACGACGCAGTGCTGTTGTGTGCGCAAATCAAGGCCGACGGTAGGGTCGACGATATGTGGTTGACGCAGA
TCCGCCGCCATCGCACCGCCCGCCCCATCGATGCAATCGTGCTGGTACTCGACGAATCGACGATTCTGCC
CGACTCGGTCCGAGGCACGAGCAGCCCCTGGGGCCTCCACCTCGCGCGCATCAGCAACTTGCTGAGGTGG
GCCGCGCCAGTATTTGTGCTCGACCTTGCGGGTTCGGATGCCGTTCATCGTGCGGACACTCCCGTGAATG
GCTGCGAGCTTTCACGAGCGAGCGATGCATCCGCCGTCGAAACCGCGCTACTCGAATTACGCAATCGCTT
GGCCGACGTCAGTGTCGGCCAGCTCGCGCACAACCCTGCCGACCGCTACGCGTCAGATCTCTCGATCCGT
CTCGATACGCGCAGCGCACCGCTGGCTCGCTGGCTCGCGAGCTTGTCCGACTGGCAACGTCGTGCCCAAC
CGGTTGCCGGTGTGATGTTCGCACCGTGGCCGGCATCCGGAGCGACGACAACGGGCACCGACAGTCTTCA
CTTTCCGTTGTGGCGCTATCTGACCGATGCAGCCAGGCGTACGCCGGGCCGCCGCACGGCGACGCATCCT
TTCACGATGGTCTCGGGAATTGCGCTGGCCGCCGTCGGACTGTGGGGCGCCGGCATGCTCATCTCGGGCC
TGACGAATGCCCGCGGCCTGGCGCTGACGAATGACGTGCTTCGCACGTTCAACGGCGCCAACAGTCCGGC
GACCCGTCTGCGCGCCTTGCTCGCGCTCCAGCAGCGCATCGAGTTCTACGAAGCGCGCGTCGAGCGTCCG
ACACTGTTCTCGCGCTTCGGCCTGAATCACGATCAGGACGTGCTCACCGCGTTATGGAAGCCCTATGTGC
GCGAAGCGCGCCCGCAACTGCTTGCGCCCGTGCAACAGGACATCGAAGGGCAACTGGTCGATCTCACGCA
GATGCCGACCGCCCAAGTCGATGACCAGGTCAATCGCCTCGCTCGCGACGGTCACGCCACGCTCAAGACG
TACCTGATGATGGCGGACCCGTCGCGCGCCGATGCGGCGTTCATGACGCCGCAACTGGTGCGCCATTGGA
ACGGCGGCATCGGACTGTCTCCGGGCGAAAAGCTCGACCTGTCGCAGCGGCTGCTGGCGTTCTACGCGCA
GCACCTCGGCGCGCATCCCGACTGGCGCATCGCCGCGCGTGACGAGCTCGTCGCGGGCGCCCGCCAGACC
TTGCTCGCCGTGATCGGCGTGAAAAACTCGGAAGACATGATCTATCAGGGCATCCTCGAATCGGTCGGTC
GCAAGTACCCGGACCAGACGCTCGCGTCTCTGACCGATGGCACCGACACGCGCGGACTGCTGAAAACCAC
GGCCAGCGTGCCCGGCGCGTACACGCGTCAGGCATGGGACGGGACCATCGAGGCCGCGATCGACGACATG
GCGAAACGCAATGGCGTGACGGCCGACTGGGTGCTCGGCGCGACCAGCGCCAATCGCAACGCGTCGGCCG
CGACGCCCGAGGCGCTGCGCGCGTCGTTGCGCACGCGCTACTTCGCGGACTATGCGGACCGTTGGCAAAC
CTTCATGAACAGCATCACGTGCGAACCGGCGCGGACCTTGCCGGCCGCCGTCGCGCAGTTGAAACTCATC
GCCGATTCGCGGCAGTCGCCGGTGATCTCGCTGATGAAGTCGCTCGAGTTCCAGGGCGGAGCGGGCGTCG
TGAAGACATCGCTGTCCGACACCCTGGTGAACAAGGCGCAGAACATGTTCGCGAGCAAGGACAATGCGCC
GCAGCCGGCCGCGCCCGACCCGGCCGGACCGCTCGGCGTGTCGTTCGGCCCCGTGTTGCATCTGATCGCA
CCGGGGAACGCTGCGACGGCAGGCGCAACGAGCGACCTGAGCCTGCAGCGTTTCATCGAACGCATCACGA
TGCTGCGTCTGAAGCTGCAACAAATCGCTGACAGCCCGGACGCCGATAGCGAGTCGCGACAAGTCGCGCA
GTCGCTGTTCCAAGGCAAGAGTTCGGAACTGGCCGACACGCTCGCCTATGCGCAGCTTGTCGCCGCCAGT
CTCGGCGAGCAGTGGGCGGGGATGGGGCAGTCGCTGTTCGTGCAGCCGGTCACGCAAGCCACTCAGGCCA
TTCTGGAGCCGGCACAGGCGAGCTTGAACGACGCATGGCGCCAGACCGTCGTCGCGAGCTGGAACCGCTC
GTTTGCCGGCCGCTATCCGTTCGCCAACACCAACAACGACGCATCGTTGCCGGAGCTGTCGCGCTTCCTG
CGACCGCAGGGCGGCTTGGTCGGCGTGTTCCTCGCCACGCAGCTGGCGGGCGTGCTGACGTTGCAGGGCG
ACCAATGGGTGCCGGCATCGAGCGGTTCGGGCGCGAGCAGCGCGGCGCGCACGATCGATCCGGCCTTTCT
CAATGCGATCAACATGCTGCAGCGGATCGCCAATCACCTGCTGGCGCAGGGCGAGCCGCAGTACGCATTC
GACCTCAAACCGGTACCCAGCCTCGGCGTGACGGACACGCGCCTAACGGTAGACGGTCAAAAGCTGCACT
ACTACAACCAGCAGGAGACGTGGCAGACGTTCACGTGGCCGTCGAACGAGCCGCAGAAGGCGGGCACGCG
TCTCGAATGGCAGACCGAGCGAGCGGGCACGAACCTGAACATGGAATTCGGCGGCCGGTGGGCGCTGGTC
CGGCTGCTGGAGCGAGCACACGTGAGCCCGGTGGATACGGCCACCTATCTGATCACTTGGCAGGCCGCGC
CGCAGTCGAAGGCAGGCGCCGCGAAGACGGACGATGGCGAGTCGTTGACCGCGCAGGCGCCGCTCGCTCC
CGCGCCGGCATCGCTGGCGTATCCGCTCACCTATTTGATGCGTACCGATGTCGGCAAGGGGCCGCTCGAA
CTGCTGGCGTTGCGCGGGTTCGCATTGCCTTCACGCGTCTTTGTGCCCCGAACGACGCCGTCCCGAGCGG
CCGGTACGGCGTTGCAGCCGCCGCCGCTTCCGCCGGGCGCGCTCGCCGCGGCGCGCCACGCGTCCGTGCC
GATCCCCGGCGGGGCGCTGCCCGAATGA
 Primer design