SecReT6
Protein ID: 134294583
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0471
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]508399..512340 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4JB30
KEGG IDbvi:Bcep1808_0471
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 3.60E-52, Aligned region: 498..876
DUF1215 [PF06744], Evalue: 5.00E-30, Aligned region: 1009..1124
Protein Sequence: 1313 a.a.     [Download]
>gi|134294583|ref|YP_001118318.1| ImcF domain-containing protein [Burkholderia vietnamiensis G4]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAILVLWLAVALWRRWRVKRANQQLG
QVLEEQAETGKITAPAAAALAPDTKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDEKRDVVTLFDERFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
ALRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAQRFGLDASALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPMSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGAMPVSTNPPGATPLAGAAQGASATPAAAPQQPAAPQGGLYSDASP
TNVQDAYNALKTYLMLADKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLSRVNDDD
WPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLIAGSYAIPGTF
TREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIAV
QGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQWFTRSQAGQM
AAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLM
QQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFSVVIQPASAEVNKVWNAQVYQPFQ
SSLATKYPFAPNAKVEAGAGEIAQVFGPDGAIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTNG
FARWVAPLAGGAAGGAAAASEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPG
ATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWVQGSVNVSVTMRIISTSQPTGGGGD
QPQQQSLRGLQLPSSIADASAGAAQNATQAGAGAPAAAPAVAAATATNAQGAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|134294128|ref|NC_009256.1|:c512340-508399 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CGATTCTCTTCATCGTCGCCGACATGCTGCAGCTGCCGCTGCTGTGGGCCGCGCTCGCGTTCGCGGCGAT
CCTCGTGCTGTGGCTCGCCGTCGCGTTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTCGAAGAACAGGCCGAAACCGGCAAGATCACGGCGCCCGCCGCGGCCGCGCTCGCGCCCGACA
CGAAGACCGCCGACCTCGACGTGCTGCGCACGCGCCTGTCCGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCGGTGCTGAACTCCGGCCTGCAGTTCCCGTTCGCCGACAAGAACAGCGCGGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACGGC
CGGCCGCTACTCGGTGCACGAGGAAGACCGCAGCGAGTGGCTCGGCTTTCTCGGCCTGCTGAAACGCTAC
CGGCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAGCTCACCGGCAACCGCCCCG
AGTTCGCGATCAACCTCGCGAAGAACCTGCGTCAGCGCGTCCAGGAGCTGACCGAAAAGCTCGAAGTGTT
CGCACCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAATACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAACCGGACGAGAAGCGCGACGTCG
TCACGCTGTTCGACGAGCGCTTCGAGGAGCTGTACGAGGGGCTGAAGGAGATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGCTCAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
GCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCACTGCAGGAAGGCGAGACCAACAGCGCCGCCGCGCAGCGCATCGCTCAGCGCTT
CGGCCTCGACGCGAGCGCGCTGCCGAAGCCGCACAGCGCATTTTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGTCAGACCGTGCGCCAGTTCGCGAGCCCCACCAAGACGCGGC
TGCGTTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCCAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGGCTGCAGGCGATGGACATTCTCGAAGACCGCATCGAGCAGCTCGAGCAGT
TCCGCCGCGACAAGCCGATGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGCCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTGCGGCAGATCCTGCTCGCGCCGGTGTCGCAGAATCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAGCAGCTCGTACCGATGACGCGTCCGCCCGAATCGGGCGCGGTGCAGG
GCGGCGCGATGCCGGTCTCGACCAATCCGCCGGGCGCCACGCCGCTCGCCGGCGCCGCGCAAGGCGCGTC
GGCCACGCCGGCCGCCGCGCCGCAACAGCCGGCGGCACCGCAGGGCGGCCTCTACAGCGACGCGTCGCCG
ACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTCGCCGACAAGCGTCACGTCGAGC
AGGCGCACCTGACCGACCAGCTTGCGCGCTTCTGGCGCGGCTGGCTGGAGACGAACCGGGGCAACATGCC
GCGCGACGAGATGATCAAGAGCGCCGAGCGGATGATCTCGTTCTATCTGTCGCGCGTGAACGACGACGAC
TGGCCGATGATCGACGCGAACCTCGCGCTGGTCGACCAGACGCGCGAGAACCTGCGCCGCGTCGTGCGCG
GCATGCCGGCGCGTCAGCGCGTCTACGAGGAAATCAAGGCGCGCGCGTCGACCCGCTTCGCGCCGATGAC
CATCGCGCGCATCGTCGGCGACGGCAACCAGGGGTTGATCGCCGGCAGCTACGCGATTCCGGGCACGTTC
ACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCGACCAAGGAACTGCAGGCGA
AGGACTGGGTGCTGAACACGTCGACGCAGGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCAGAA
GACGCTGGTCGGCATGTACAAGACCGAATACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTG
CAGGGCTTCACGAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTGGGCGACCCGCAGGATTCGCCGA
TCCGCAAGATCCTCGAGACCGCGTACGACCAGACCTCGTGGGACAACCCGTCGCTCGCGAACGTGACGAT
CAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTGAAGCAGTGGTTCACGCGCTCGCAGGCCGGCCAGATG
GCGGCCGCGAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGTTCG
TCGGGCTCGCGCGGATCGTCGCGACGCACGACGGCACGTCGATGCTCAAGGGCTACATGGACACGCTGTC
GAAGGTGCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGTCAGCTGATG
CAGCAGACGCTCGACGGCAACGGCTCGGAGCTGGCCGATTCGCTGAAGTTCGTCGACGAGCAGATGCTGA
CGGGCCTCACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTTCTC
GGTCGTGATCCAGCCGGCCAGCGCGGAAGTGAACAAGGTGTGGAACGCGCAGGTGTACCAGCCGTTCCAG
AGCTCGCTCGCGACCAAGTACCCGTTCGCGCCGAACGCGAAGGTCGAGGCCGGCGCCGGTGAAATCGCGC
AGGTGTTCGGTCCGGACGGCGCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCGGTGCGCCG
CGGCGACACCCTCGCCGCGCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCGGACTTCACGAACGGC
TTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGTGCGGCAGGCGGCGCGGCCGCCGCGTCCGAACCGCAGA
CCGTGTTCCAGATCCTGCCGCAGCCGAGCACCGGCACGACCGAATACACGATCGCGATCGACGGCCAGCA
ACTGCGTTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGTTCGCCCGGC
GCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACGGTC
TCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGCCCGGACGGCACGTTCGATCTGACGTGGGTCCA
GGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAGCCGACCGGCGGCGGCGGCGAC
CAACCTCAGCAGCAGAGCCTGCGCGGTCTGCAGCTGCCGTCGTCGATCGCCGACGCGAGCGCCGGCGCCG
CACAGAACGCGACGCAGGCGGGCGCCGGCGCGCCGGCCGCGGCACCGGCCGTCGCGGCCGCCACCGCAAC
GAATGCACAGGGGGCGCAATGA
 Primer design