SecReT6
Protein ID: 13472148
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2349
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1897448..1900990 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ98IL5
KEGG IDmlo:mlr2349
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-87, Aligned region: 190..449
ImcF-related_N [PF14331], Evalue: 3.40E-87, Aligned region: 465..489
IcmF-related [PF06761], Evalue: 1.80E-72, Aligned region: 508..803
DUF1215 [PF06744], Evalue: 5.90E-34, Aligned region: 921..1040
Protein Sequence: 1180 a.a.     [Download]
>gi|13472148|ref|NP_103715.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MFILRFLWAVITSRFLWTLIGIALLSLLIWVFGPIVQVGQYAPFESDNVRIAIIAGLIILWLIWLIIAQR
RAIRANRMFVAEIAAPVTEKQLTPGEESVAAVGAKFGEVMAELKRRKLGGRKFLREMPWYVIVGPPATGK
TTALRQSGLNFPIDLTDDLQGVGGTRNCDWFFSENAVLIDTAGRYVQQESQPDVDAAEWLGFLDLLKKHR
GRRALNGVIVALSIDALSEGDEAIKAHGRKIRRRLAELNDRLEIRLPVYLMLTKADLIKGFEAFFGGLST
SAREQVWGTTFPLDARVNAGMIEAELARLGTELERRLVPRLEDEDKLASRAEIFRFPAQLASLRGPIQVL
IEAMFGESRYEEAAWLRGLYLTSATQEGAPIDRLTAALSSSFGLPPRRAMPAARVEKRSFFLRNLLTEVI
FKEAGLGTFDPLAQRRRAWIWRGAAAACALAALLAGGLFTWSYLDNRNAITEQAGQFEALQGPLTQVAAT
PAAVEQPTMDGALAAMDAVATARTPPPDAVHNLLGPTASPELVRAQTDTYDHALRNVLEPHMVALLEATM
WRQIRDPDFMLGALKTYRMMTGLSQMDTDFVQNWWVNSLPQFAPAPPFPTADAEEHQIAAIRRMAVDDSY
IAPDKALVAEALKTVCTISLPERAYKQLLADPEVAALKEWVPANFAGPNGAKVFARRSDKTLRVGVPGPY
TYAGFHDAILDRVEDVAGQAALDRAVFAGGCSENSETSVSALSQDILKLYYDDYIAQWDSFLRDMRLAPL
TDLNIASENLKDLSSADSALKRLLTAVVQETDLTRSDDAPADDKSGAAAKSGSKLLSKLGKLGKVVTSGA
KLLPRAGSANQVDMTGSLVADHFKPLKGTIAQVDGQPPALDAAVVALTALSNVLQTVTANPNPQDAIKKQ
GGLAELTGAVARQAQILPSPINEWLGGIAGDTSGLSQKAVTNELNAIWRADILPFCQAALNNRYPFSPDS
AVDVNVRDFQRLFGPTGLIDAFTTDHLINYVDTASEPWKWRADFGLDPAALAAFEQARHIRDDLFPGGTG
PVMNFTLEPKDLSPNVARVTLNLDGQNLVYYNNATRPQPMTWPGKDGTGVISLAFQPVDGSPEVMLNETG
SWAWLRMLRGGRFAATKLTDVYSLRLGTKGMWADFELKAASVENPYTLEMFKKFTCPPQI
 
Nucleotide Sequence: 3543 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1897448-1900990 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGTTCATCCTGCGCTTCCTCTGGGCGGTCATCACTTCGCGCTTTCTCTGGACGCTGATCGGCATAGCGC
TGCTTTCGCTTTTGATCTGGGTGTTCGGCCCGATCGTCCAGGTCGGCCAGTACGCGCCGTTCGAATCCGA
CAATGTGCGCATCGCCATCATCGCGGGGCTGATCATCCTGTGGCTGATCTGGCTGATCATCGCGCAACGG
CGCGCGATCCGCGCCAACCGCATGTTCGTCGCCGAGATCGCGGCACCCGTGACCGAAAAGCAGCTGACCC
CCGGCGAGGAGAGCGTTGCAGCCGTCGGTGCCAAGTTCGGCGAGGTCATGGCCGAGCTCAAGCGGCGCAA
GCTCGGCGGACGGAAATTCCTGCGCGAGATGCCGTGGTATGTGATCGTCGGGCCTCCGGCCACCGGCAAG
ACCACGGCATTGCGCCAGTCGGGCCTCAATTTTCCAATCGATCTGACCGATGATCTGCAGGGTGTCGGCG
GCACGCGCAACTGCGACTGGTTTTTCTCCGAGAACGCAGTGCTGATCGACACTGCGGGCCGCTACGTCCA
GCAGGAGAGCCAGCCGGACGTCGACGCCGCAGAATGGCTGGGCTTCCTGGACCTTTTGAAGAAGCACCGG
GGCCGGCGCGCGCTCAACGGCGTCATCGTCGCGCTGTCGATCGATGCGCTCTCGGAGGGCGACGAAGCGA
TCAAGGCGCACGGCCGCAAGATCCGCCGCCGACTGGCGGAGCTCAACGATCGCCTGGAGATTCGTCTGCC
TGTCTACCTGATGCTGACGAAGGCCGACCTGATCAAAGGGTTCGAAGCCTTCTTCGGCGGCTTGTCGACA
AGTGCGCGCGAGCAAGTGTGGGGAACCACCTTTCCGCTGGATGCCCGCGTCAACGCCGGCATGATCGAGG
CGGAGCTGGCCAGGCTTGGCACCGAGCTGGAGCGAAGGTTGGTGCCGCGCCTTGAGGACGAAGACAAGCT
TGCCTCGCGCGCCGAGATCTTTCGTTTTCCGGCGCAGTTGGCGAGCCTCCGCGGGCCGATCCAGGTGTTG
ATCGAGGCCATGTTCGGCGAAAGCCGCTACGAGGAAGCCGCATGGCTGCGTGGCCTTTATCTGACATCGG
CGACACAGGAAGGAGCCCCCATCGACCGCCTGACCGCGGCGTTGTCATCGTCCTTCGGGCTGCCGCCGCG
CCGCGCCATGCCGGCGGCGCGCGTCGAGAAGCGCAGCTTCTTCCTCAGGAACCTTCTCACCGAAGTGATC
TTCAAGGAGGCGGGCCTTGGCACATTCGATCCGCTGGCGCAGCGCCGCCGCGCCTGGATCTGGCGCGGGG
CCGCCGCCGCCTGTGCGCTCGCGGCCCTGCTGGCCGGCGGACTGTTCACCTGGTCCTACCTCGACAACCG
CAATGCGATCACCGAACAGGCCGGCCAGTTCGAAGCCCTGCAGGGGCCGCTCACGCAAGTGGCCGCCACG
CCGGCCGCGGTCGAGCAGCCGACCATGGATGGCGCGCTGGCGGCGATGGACGCGGTGGCGACCGCCCGAA
CGCCGCCACCAGACGCCGTCCATAATCTGCTCGGCCCGACCGCTTCGCCGGAGTTGGTGCGCGCGCAGAC
CGATACCTACGACCATGCGCTGCGCAACGTGCTCGAGCCGCATATGGTCGCCCTGCTCGAGGCCACGATG
TGGCGGCAAATCCGCGATCCGGATTTCATGCTTGGCGCGCTGAAGACCTACCGGATGATGACCGGCCTGT
CGCAGATGGACACCGATTTCGTCCAGAACTGGTGGGTGAACAGCCTGCCGCAATTCGCGCCGGCTCCGCC
TTTCCCCACGGCCGACGCCGAAGAGCACCAAATCGCCGCCATCCGCCGCATGGCCGTCGACGACAGCTAC
ATCGCCCCGGACAAGGCACTGGTCGCGGAGGCGCTGAAGACTGTATGCACGATCTCACTGCCGGAGCGCG
CCTACAAGCAGCTCCTCGCCGACCCGGAAGTAGCCGCCCTCAAGGAATGGGTGCCGGCCAATTTCGCCGG
GCCGAACGGCGCCAAGGTGTTCGCGCGCCGCTCCGACAAGACGTTGCGCGTCGGCGTTCCTGGCCCCTAC
ACCTATGCCGGTTTCCACGACGCGATCCTCGACCGGGTCGAGGATGTAGCCGGACAGGCGGCCCTCGATC
GCGCGGTGTTTGCCGGCGGCTGCTCGGAGAATTCGGAGACGTCGGTCTCGGCGCTCTCGCAAGACATCTT
GAAGCTCTACTATGACGACTATATCGCCCAGTGGGACTCCTTCCTGCGTGACATGCGGCTTGCGCCGCTT
ACAGATCTCAACATCGCCAGTGAAAACCTCAAGGATCTTTCCAGCGCCGACTCCGCGCTGAAGCGCCTGT
TGACGGCAGTGGTGCAGGAGACCGACCTCACCCGCTCCGACGATGCGCCGGCCGACGACAAAAGTGGCGC
TGCCGCCAAGAGCGGCTCCAAGCTGCTCAGCAAACTCGGCAAGCTGGGCAAGGTGGTGACCTCGGGCGCC
AAGCTCCTGCCGCGTGCCGGCTCCGCCAACCAGGTGGACATGACCGGCAGCTTGGTTGCTGATCATTTCA
AGCCGCTCAAAGGCACCATCGCCCAGGTCGACGGCCAGCCGCCAGCGCTCGACGCCGCCGTCGTGGCGCT
GACGGCGCTGTCGAATGTGTTGCAGACGGTGACCGCCAATCCCAACCCGCAGGATGCGATCAAGAAGCAG
GGCGGCCTCGCCGAACTGACAGGCGCGGTCGCCAGGCAGGCGCAGATCCTGCCCTCGCCGATCAACGAGT
GGCTGGGCGGCATTGCCGGCGACACCAGCGGCCTGTCGCAGAAGGCCGTCACCAACGAGCTCAACGCCAT
CTGGCGGGCTGACATCCTGCCCTTCTGCCAGGCGGCGCTCAACAACCGCTATCCGTTCAGCCCGGACAGC
GCGGTCGATGTCAATGTGCGCGACTTCCAACGTCTGTTCGGACCGACCGGCCTGATCGATGCCTTCACCA
CCGACCATTTGATCAACTATGTCGACACCGCAAGCGAGCCGTGGAAATGGCGTGCCGATTTCGGCCTCGA
CCCGGCGGCGCTCGCAGCGTTCGAGCAGGCGAGGCATATTCGCGACGATCTGTTTCCGGGCGGCACCGGC
CCGGTGATGAACTTCACGCTGGAGCCCAAGGACCTCTCCCCCAACGTGGCGCGGGTCACGCTTAACCTCG
ATGGCCAGAACCTCGTCTACTACAACAACGCCACCAGACCGCAACCGATGACGTGGCCCGGCAAGGATGG
CACCGGGGTGATCTCGCTCGCCTTCCAGCCGGTCGACGGCTCGCCCGAAGTGATGCTCAACGAGACCGGC
AGCTGGGCGTGGCTCAGAATGCTGCGCGGCGGCCGCTTCGCCGCGACCAAGCTCACCGACGTCTACAGCC
TGCGGCTCGGCACGAAGGGGATGTGGGCCGATTTCGAACTCAAGGCCGCCAGCGTCGAGAACCCCTACAC
GCTCGAAATGTTCAAGAAGTTCACATGTCCGCCGCAGATCTGA
 Primer design