SecReT6
Protein ID: 13472159
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2360
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1911989..1915519 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ98IK4
KEGG IDmlo:mlr2360
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-89, Aligned region: 177..437
IcmF-related [PF06761], Evalue: 9.60E-79, Aligned region: 489..800
IcmF-related [PF06761], Evalue: 9.60E-79, Aligned region: 905..934
DUF1215 [PF06744], Evalue: 5.30E-36, Aligned region: 286..315
DUF1215 [PF06744], Evalue: 5.30E-36, Aligned region: 913..1037
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 113..131
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 164..190
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 391..423
RskA [PF10099], Evalue: 0.0078, Aligned region: 37..93
RskA [PF10099], Evalue: 0.0078, Aligned region: 421..481
Protein Sequence: 1176 a.a.     [Download]
>gi|13472159|ref|NP_103726.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MRWMLRIFSVLALAGFSAAVWYAGPLLRFADTRPLGSVWLRALIIGLTVAVLALFYGIGFWQRRKAQKAL
EAAIVRSDERNDDAQVLEARMSEAIATLKRTSGKRNFLYDIPWYIIIGPPGAGKTTALVNSGLKFPLAGS
GNAQPVAGVGGTRSCDWWFTDEAVLIDTAGRYTTQESDRERDKASWLAFLGLLKKNRVRQPINGVILAIS
LADLIGLDDQHIEAHVTEIRSRLRELHETLKIQFPVYLLFTKADLVSGFMDYFGQFDEARRRKVWGATFQ
TADRTRNMAGEAPAEFDGLAKRLADEIADRLQEEADPVARIAIFGFPAQFGALRNRIAHFIASLFDASRS
QVNVSLRGLYFSSGTQEGTPFDQVLGAIGRSFGSTSQAHFSGTGKSFFLHDLLTNVIFPESGWVSFDRAA
ERRARLARFGGLAAIALAASAALGVLGLSFFANKSLITSTRQAMAQYRDSADSLLKSTTVTDVDLENVIG
PLDQLRNLPAGFENGDQAKPIEETFGLSQRERLLSASRTAYRQALERTFRSRLLVQAERTIQAKMADPIA
LYEPLKIYLMLGGKAPKVDDELIVSWMRQDWEENRYPGENNREGRAQLEKHLRAMLALDDAYDPVFELNQ
PLIEAAQRSLGRMSLADRASALIKSAVYAARLEDLSVAAKAGPEAQLLFERMDGSDLADLNVPGLYTRAG
FNRFFLPQLSRIAQMLVNDQWVLGGGGEQGGIDQDLPKLGPELIDRYGKEFSSAWNRVLDQLKFKALLKD
RPQYLALSALAAPDSPLDQLFTAIADETALTKQNTTADGESNAAQEDPASMAKGLARIGLQIAGGKSQSR
AGLGSAVAQNAGASVEAQFRPFQALVSGVSGRRPLDALTRNFRDIFQSLKLSADVPSQTERVNANLQLQI
STLRANASRLPKPLARMVNAAADEFEGNVAEASVANLNQNLDQTVTRACEEAVNGRYPFASDGTEDISIA
DFAKLFAPGGLMDRFFAQNLAPLIDMTGQEWTWRQDVRSSRDLAKSTLKSFQSAAEIRSAFFPSGGSVPS
VSITITPFSLNSDADNAVLNIDGQTVQSSQTGNAPSTVTWPNGTASGSASLSLMPEMPGRDSALKFEGPW
ALKRLLDKATITANGANTEARFVIGGRDVAYTMQTGPGTSPFLLPALSGFSCPKAF
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1911989-1915519 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCGCTGGATGCTGCGGATATTCAGCGTGCTTGCCTTGGCCGGCTTCTCGGCCGCCGTCTGGTATGCCG
GACCGCTGCTCCGCTTCGCCGATACCCGCCCGCTCGGATCCGTGTGGCTCAGGGCGCTCATCATCGGACT
GACGGTGGCGGTGCTGGCGTTGTTCTACGGCATCGGCTTCTGGCAAAGGCGCAAGGCGCAAAAGGCGCTC
GAAGCGGCCATTGTGCGCAGCGACGAGCGCAACGACGATGCACAGGTGCTCGAAGCGCGCATGAGCGAGG
CCATCGCGACGCTGAAGCGGACGAGCGGCAAGCGCAACTTCCTTTATGATATTCCCTGGTACATCATCAT
CGGCCCGCCAGGCGCCGGCAAGACGACGGCTCTGGTCAACTCCGGGCTGAAATTTCCGCTTGCGGGCTCC
GGCAATGCCCAGCCGGTGGCCGGCGTCGGCGGCACGCGGTCATGCGACTGGTGGTTTACCGATGAGGCGG
TGCTGATCGACACGGCCGGCCGCTACACCACGCAGGAATCGGACCGCGAGCGCGACAAGGCAAGCTGGCT
TGCTTTCCTCGGATTGCTCAAGAAAAACCGCGTAAGGCAACCGATCAACGGCGTGATCCTGGCCATCAGC
CTCGCCGATCTCATTGGCCTCGATGACCAGCATATCGAGGCGCATGTGACCGAGATAAGAAGCCGCCTGC
GCGAACTGCACGAGACGCTGAAGATCCAGTTTCCCGTTTATCTGCTTTTCACCAAGGCCGATCTCGTCTC
CGGCTTCATGGATTATTTCGGTCAATTCGACGAAGCACGCAGGCGCAAGGTGTGGGGCGCGACGTTCCAG
ACCGCCGATCGCACAAGGAACATGGCCGGCGAGGCGCCGGCCGAATTCGACGGGCTGGCGAAACGCTTGG
CGGACGAAATTGCCGATCGCTTGCAGGAAGAGGCCGACCCGGTTGCGCGCATCGCCATCTTCGGCTTCCC
GGCACAGTTCGGTGCCCTCAGGAACCGGATAGCGCATTTCATCGCCAGCTTGTTCGATGCCTCTCGATCG
CAGGTCAATGTCAGCCTGCGGGGCCTCTACTTCTCCTCTGGTACTCAGGAAGGAACACCGTTCGACCAGG
TGCTGGGCGCAATCGGCCGCAGCTTCGGCAGCACCTCGCAGGCGCATTTTTCCGGCACCGGCAAGAGCTT
CTTCCTGCACGATCTGCTGACCAATGTGATCTTCCCGGAATCGGGCTGGGTATCCTTCGACCGAGCGGCC
GAACGGCGCGCCAGGCTCGCGAGATTTGGCGGCCTCGCCGCTATTGCGCTGGCGGCCTCGGCGGCTCTCG
GCGTGCTTGGCCTCAGCTTCTTCGCCAACAAATCGCTGATCACCTCCACCAGGCAGGCGATGGCACAGTA
TCGCGACAGCGCCGATTCGCTGCTCAAGAGCACGACAGTGACCGACGTCGACCTGGAAAACGTCATCGGC
CCGCTCGACCAGCTGCGCAACCTGCCGGCCGGCTTCGAGAACGGCGACCAGGCAAAGCCGATCGAGGAGA
CGTTCGGGCTCAGCCAGCGCGAGAGGCTGCTGTCAGCCTCCAGGACCGCCTATCGGCAAGCGCTCGAGCG
GACATTCCGCTCCCGGCTGCTGGTGCAGGCCGAGCGCACCATCCAGGCCAAGATGGCCGATCCCATCGCA
CTCTACGAACCGTTGAAGATCTACCTGATGCTTGGCGGCAAGGCTCCGAAGGTCGATGACGAGTTGATTG
TTTCCTGGATGAGGCAGGATTGGGAAGAGAACCGCTATCCCGGCGAGAACAACCGCGAGGGCCGCGCGCA
GCTCGAAAAACATCTGCGCGCCATGCTCGCGCTCGACGACGCCTACGATCCCGTCTTTGAGCTCAACCAG
CCACTGATCGAGGCCGCGCAACGCTCGCTTGGGCGCATGAGCCTTGCCGACCGCGCTTCGGCGCTGATCA
AGTCGGCGGTCTACGCCGCAAGGCTGGAGGACCTCTCCGTCGCCGCGAAAGCCGGCCCTGAGGCGCAGCT
TCTGTTCGAACGCATGGATGGCAGCGACCTCGCCGATCTCAACGTTCCTGGACTTTACACGCGCGCCGGC
TTCAACCGCTTCTTCCTGCCGCAGCTCTCGCGCATCGCGCAAATGCTCGTCAACGACCAGTGGGTGCTCG
GCGGAGGCGGCGAACAGGGCGGCATCGACCAGGACCTGCCCAAGCTCGGCCCCGAACTGATCGATCGCTA
CGGCAAGGAATTCTCATCCGCATGGAACCGCGTGCTCGACCAGCTCAAGTTCAAGGCGTTGCTCAAGGAC
AGGCCGCAATATCTCGCGCTTTCCGCCCTCGCCGCGCCGGACTCGCCTCTCGATCAGCTGTTCACCGCGA
TCGCCGATGAGACTGCATTGACGAAGCAGAACACCACGGCCGACGGCGAGAGCAATGCGGCGCAGGAAGA
CCCCGCCAGCATGGCCAAAGGTCTGGCACGCATCGGCCTGCAGATCGCCGGCGGCAAGTCGCAGAGCCGA
GCCGGATTGGGCTCGGCCGTAGCCCAGAATGCCGGTGCGAGCGTCGAGGCACAGTTTCGACCGTTCCAGG
CCCTGGTCAGCGGCGTCAGTGGACGGCGGCCGCTCGATGCGTTGACGCGGAATTTCCGCGACATATTTCA
AAGCCTCAAGCTTTCGGCAGATGTGCCTTCACAAACCGAACGCGTCAACGCCAACCTGCAGCTGCAGATC
TCCACGCTGCGCGCCAATGCCTCACGCCTTCCGAAGCCGCTTGCGCGCATGGTCAACGCGGCAGCGGACG
AGTTTGAAGGCAATGTCGCCGAAGCCTCGGTGGCCAACCTCAACCAGAACCTCGACCAGACGGTCACACG
AGCCTGCGAGGAGGCGGTCAACGGTCGCTATCCCTTCGCCAGTGACGGCACCGAAGATATCTCGATAGCG
GATTTCGCCAAGCTTTTCGCGCCGGGCGGGCTGATGGACCGCTTCTTCGCGCAGAACCTGGCGCCGCTGA
TCGACATGACCGGCCAGGAATGGACCTGGAGACAGGATGTCCGCTCCAGCCGCGACCTGGCGAAGTCGAC
CTTGAAATCATTTCAGTCGGCCGCCGAAATCCGCAGCGCCTTCTTCCCTTCCGGTGGCTCGGTGCCGTCG
GTTTCGATTACCATCACGCCTTTTTCGCTGAACAGCGACGCCGACAACGCGGTTCTCAACATTGACGGCC
AGACCGTCCAGAGCAGCCAGACGGGGAATGCGCCAAGCACAGTGACCTGGCCAAACGGCACTGCCTCTGG
TTCCGCCAGCCTCAGCCTGATGCCGGAAATGCCAGGCCGCGACTCCGCTCTCAAATTCGAAGGACCGTGG
GCCTTGAAGCGTCTGTTGGACAAGGCGACCATCACCGCCAATGGCGCCAACACCGAAGCCCGCTTCGTGA
TCGGCGGACGAGACGTCGCTTACACGATGCAGACCGGGCCGGGGACCAGTCCCTTCCTGCTGCCGGCCCT
GTCCGGCTTCAGCTGTCCGAAGGCGTTCTGA
 Primer design