SecReT6
Protein ID: 145598776
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1492
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1680940..1681998 [-]
Producthypothetical protein
NotePAAR
UniProt IDA4TKR7
KEGG IDypp:YPDSF_1492
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.20E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 3.50E-10, Aligned region: 10..65
Protein Sequence: 352 a.a.     [Download]
>gi|145598776|ref|YP_001162852.1| hypothetical protein YPDSF_1492 [Yersinia pestis Pestoides F]
MAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVNGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>ref|NC_009381.1|:c1681998-1680940 hypothetical protein YPDSF_1492 [Yersinia pestis Pestoides F]
ATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCTGCGGCGGCGTGATCATCGAAGGTGACG
CCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGACAGAGTGACCTGCGGTAAACATCCGGG
AACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAATGGCCGCAAGTTTGCGGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCGATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACTCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA
 Primer design