SecReT6
Protein ID: 145598787
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1503
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1696819..1699167 [-]
Producthypothetical protein
NoteTssI
UniProt IDA4TKS8
KEGG IDypp:YPDSF_1503
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-64, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.30E-47, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 629..650
Phage_base_V [PF04717], Evalue: 8.80E-16, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|145598787|ref|YP_001162863.1| hypothetical protein YPDSF_1503 [Yersinia pestis Pestoides F]
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRI
TSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPADLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>ref|NC_009381.1|:c1699167-1696819 hypothetical protein YPDSF_1503 [Yersinia pestis Pestoides F]
ATGAATACCTTTCTCCCGACTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGGCCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
ATCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGACCTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCCATGCCCGCCGCGACCGCAGCTATGAAGTACATTTTGAAGCCATTCCTTACTCCGAGGATTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCTTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATCGCGTTTGAAGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTACACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTGGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGATAACCTGATTGCCACCGCCGGTAAAAATG
CCGACGTCAGCGTCGCGAAAAATTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACCATTACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAACTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA
 Primer design