SecReT6
Protein ID: 145598788
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1504
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1699170..1701812 [-]
ProductATPase subunit of ATP-dependent protease
NoteTssH
UniProt IDA4TKS9
KEGG IDypp:YPDSF_1504
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 611..775
AAA [PF00004], Evalue: 9.60E-20, Aligned region: 239..351
AAA [PF00004], Evalue: 9.60E-20, Aligned region: 616..734
ClpB_D2-small [PF10431], Evalue: 7.20E-15, Aligned region: 782..860
AAA_5 [PF07728], Evalue: 8.30E-15, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 8.30E-15, Aligned region: 337..369
AAA_5 [PF07728], Evalue: 8.30E-15, Aligned region: 615..736
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 127..197
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 216..260
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 454..532
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 588..659
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 3.20E-11, Aligned region: 753..797
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 239..304
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 293..327
AAA_25 [PF13481], Evalue: 2.10E-08, Aligned region: 613..644
AAA_22 [PF13401], Evalue: 3.50E-08, Aligned region: 61..111
AAA_22 [PF13401], Evalue: 3.50E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 3.50E-08, Aligned region: 614..652
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 217..254
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 608..654
Arch_ATPase [PF01637], Evalue: 4.40E-07, Aligned region: 685..702
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 232..300
IstB_IS21 [PF01695], Evalue: 7.70E-07, Aligned region: 615..635
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 239..325
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 615..636
NACHT [PF05729], Evalue: 3.00E-06, Aligned region: 743..760
Zeta_toxin [PF06414], Evalue: 9.60E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 9.60E-06, Aligned region: 449..516
Zeta_toxin [PF06414], Evalue: 9.60E-06, Aligned region: 614..655
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 236..260
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 613..637
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 614..705
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 614..651
Sigma54_activat [PF00158], Evalue: 5.70E-05, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 5.70E-05, Aligned region: 615..732
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 23..59
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 111..124
Clp_N [PF02861], Evalue: 0.00089, Aligned region: 453..472
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0018, Aligned region: 575..636
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 616..637
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 239..266
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 616..645
AAA_33 [PF13671], Evalue: 0.0064, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0064, Aligned region: 614..637
DUF258 [PF03193], Evalue: 0.0065, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0065, Aligned region: 615..628
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 239..260
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 614..660
Protein Sequence: 880 a.a.     [Download]
>gi|145598788|ref|YP_001162864.1| ATPase subunit of ATP-dependent protease [Yersinia pestis Pestoides F]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LSHLDTLPRTVQGKPQLSAALQQLIKNAWLDASLQENADAVRSVHLMAALIATPSLLVAEAAWPLLSLST
TQLQRLLPLLDNQSDERPEVQQAAALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMEINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQHTLEQQYKEEKRLTTLIIEARQDIANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPAL
LARFQTLIYRPLQVDALKRIVAIKLNQVAQRLHCHYGLSCQIEDSLTDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWHEEDGITLTFEGE
 
Nucleotide Sequence: 2643 bp     [Download]
>ref|NC_009381.1|:c1701812-1699170 ATPase subunit of ATP-dependent protease [Yersinia pestis Pestoides F]
ATGACAACGCATTCAGCACACTTATTACGTCGGTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCCG
CCACCCTGTGTCAGACCCGCGCCCATGCTGAGATCACTGTCGAACACTGGTTGTTAAAATTGCTGGAGCA
GGGCGAAGGCGATATTACAGTCATTGCCCGGCGTTATGAGTGGGACATGGACAGCCTGTGGCAGGGATTA
CTGTCCCATCTGGACACCTTGCCGCGCACGGTACAGGGCAAACCTCAGTTGTCCGCCGCGTTACAGCAAC
TGATCAAAAACGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATTGCCACGCCGTCATTATTGGTCGCCGAGGCCGCCTGGCCGTTGCTCAGCCTGAGCACC
ACTCAGCTACAGCGCCTGTTACCGCTGCTGGACAACCAGTCCGACGAACGCCCTGAGGTGCAGCAGGCTG
CGGCACTGGCCGACAGCCCGGTCAATCTGACCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTCACCCTCGACGTCACCGCCAAAGCCCGTGCC
AACCAGATTGACCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGACATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTCTGGTGGGTGAACCGGGTGTGGGGAAAACCGCGCTGGTTGAAGGGCTGGCACT
GCGGATTGCCGACGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGGGCTGGGGTGAAAGGCGAATTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGCAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCCAACCTGCTGAAACCTGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTTCTGACCGGTCGC
CAACTGCCGGACAAAGCGGTGGATCTTCTCGACACCGCAGGTGCGCGCGTGCGCATGAGCATCGACACCT
TGCCGACTGCGTTGATGGAGATTAACGCCGAACTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAGAAGCGGTTGACCACCCTGATTATTGAGG
CGCGTCAGGACATCGCCAACGCAGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATTCAGGGCAA
TGCGCCGCTGTTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGTGTG
CCGCTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTGGAAAATCGTCTGGGTGAGCGAG
TGATTGGGCAGGATGCGGCATTAGGTGCGCTGGCGCAACGGCTGCGGGCCGCCAAAACCGGCCTGACATC
AGAGAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGTTG
GCACTGGCCGACAGCCTGTTCGGCGGGGAAAAATCGCTGATCACCATCAACTTATCGGAGTATCAGGAAG
CGCACACCGTCTCCCAGTTGAAAGGGTCGCCCCCGGGTTATGTCGGTTACGGACAGGGCGGCGTATTAAC
CGAAGCGGTACGTAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAAGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGGGGGTTCATGCGCGACGGTGAAGGGCGCGAAATTGATTTCC
GCAACACGGTCATTGTGATGACCGCCAATCTGGGCAGTGATCATCTGATGCAGTTGCTGGATGAGCAACC
GGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCGATCCTACGCGACCACTTCCAGCCCGCGCTG
CTGGCCCGCTTCCAGACCTTGATTTACCGCCCGCTTCAGGTGGATGCGCTCAAACGCATTGTGGCGATAA
AACTGAATCAGGTGGCGCAACGCCTGCACTGTCACTACGGCCTGAGCTGCCAGATTGAAGACAGCCTGAC
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAG
CAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGCATGAAGAAGATGGCATCACGCTGACATTTGAGGGCGAATAA
 Primer design