SecReT6
Protein ID: 145598789
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1505
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1702200..1702691 [-]
Producthypothetical protein
NoteTssD
UniProt IDA4TI43
KEGG IDypp:YPDSF_0544, ypp:YPDSF_1505
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|145598789|ref|YP_001162865.1| hypothetical protein YPDSF_1505 [Yersinia pestis Pestoides F]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_009381.1|:c1702691-1702200 hypothetical protein YPDSF_1505 [Yersinia pestis Pestoides F]
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACCGATAACAATAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTTTTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTTAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCGTGGAACGAGCGCGCCACCGCAT
AG
 Primer design