SecReT6
Protein ID: 145598792
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1508
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1704431..1705117 [-]
Productmembrane protein
NoteTssL
UniProt IDA4TI40
KEGG IDypp:YPDSF_0541, ypp:YPDSF_1508
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|145598792|ref|YP_001162868.1| membrane protein [Yersinia pestis Pestoides F]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>ref|NC_009381.1|:c1705117-1704431 membrane protein [Yersinia pestis Pestoides F]
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTTGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCAGAGCCGGTGTAA
 Primer design