SecReT6
Protein ID: 145598794
SecReT6 ID202
T6SS typei2
Gene symbol-
Locus tagYPDSF_1510
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]1706478..1708022 [-]
Producthypothetical protein
NoteTssC
UniProt IDA4TKT5
KEGG IDypp:YPDSF_1510
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-177, Aligned region: 14..51
DUF877 [PF05943], Evalue: 2.80E-177, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|145598794|ref|YP_001162870.1| hypothetical protein YPDSF_1510 [Yersinia pestis Pestoides F]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHM
PFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHERYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>ref|NC_009381.1|:c1708022-1706478 hypothetical protein YPDSF_1510 [Yersinia pestis Pestoides F]
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAACTACGA
GTTCGACCGCAGCCCGCAAGATATCGCCTTATTGCGCAATATCTCCAAAGTGGCGGCTGCAGCCCATATG
CCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAAAGAGAACATGGAAGAAGTGGCGGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCTGAATACATCAAATGGAAAGCTTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTATGGGCCAGACACCGTGCCGGTGCGC
AGCTTTAACTACGTAGAGCAGGTGAAAGGGCCGGATCATGAGCGTTATCTGTGGACCAACGCTTCGTTTG
CCTTTGCTGCCAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGTGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTAGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTACCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCGAAGGCTAAGG
CATAA
 Primer design