SecReT6
Protein ID: 145600375
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3120
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3547679..3549268 [-]
Producthypothetical protein
NoteTssL
UniProt IDA4TQB6
KEGG IDypp:YPDSF_3120
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-43, Aligned region: 136..331
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 391..494
Protein Sequence: 529 a.a.     [Download]
>gi|145600375|ref|YP_001164451.1| hypothetical protein YPDSF_3120 [Yersinia pestis Pestoides F]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAA
AMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDS
YNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLH
TQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEP
RKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGLALAPWPG
DIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLADNATEEGR
KRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1590 bp     [Download]
>ref|NC_009381.1|:c3549268-3547679 hypothetical protein YPDSF_3120 [Yersinia pestis Pestoides F]
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGTCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAGAGTACAGCGTATGCCGCATGG
CATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGGGATAACGCCTATATTGCTGCG
GCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGCGTAACGCCGCAGAGGTCAGGC
CACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAAGAACTACCCGCAAGAAGACAT
TAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAACGGGCTGCAAACCCCAGACTCC
TACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTGAGGACTGCTTCGAACATCTGC
GGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTATGATCTGATTATGTGCCTTGG
TTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATGGATTTACGCAGCCGTCTCCAC
ACGCAACTCTACGGTCAGGACGCCACACAATCTTTGGCTATCGCGCAAGCGGTCAAAGGTTCTCCGCGTC
GCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTGCCTTTGTGCTTACGGCGTCAC
GGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTGACGTGGGTACTGCCTGAACCG
CGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCCTGAATGAAGGGTGGCTGGAGG
TCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGCGTTCCGCACGGGTGAAGCGAC
CCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTGGCATTAGCCCCATGGCCGGGA
GATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTTCCGGTAACAACAACCTCAAAC
TTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCACTCAAATCAACGAAACCCATCA
GCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGACAATGCAACGGAAGAAGGGCGC
AAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATGCCGATAAGGCCATGAAGCAAT
TCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATAG
 Primer design