SecReT6
Protein ID: 145600376
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3121
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3549265..3550620 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4TQB7
KEGG IDypp:YPDSF_3121
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|145600376|ref|YP_001164452.1| hypothetical protein YPDSF_3121 [Yersinia pestis Pestoides F]
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQASGVFP
DGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAE
GTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTEL
LGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTI
PGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIF
TVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1356 bp     [Download]
>ref|NC_009381.1|:c3550620-3549265 hypothetical protein YPDSF_3121 [Yersinia pestis Pestoides F]
ATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCCAGCATTTTCAACAACAGG
AACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCTGGCATGGGGCTTCCATAG
CCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAGGCCAGTGGTGTTTTCCCT
GACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTGATCCGGGGGAGAACTGCC
AAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTATATTGATCTGAAGAAGAG
CAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAACCATGGCGTCGCTGCTGAA
GGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCACCTTACGTGCCAGCGTCA
GTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGATGGGCGTCTGATTCTGGA
TGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGATAATGCGGTAACCGAATTG
CTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGCTCTCAGTCGGTGGGTTAT
CGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAAGATTTCACATGTGTTGAT
GCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTGGGGCGTCTCAGTACTATC
CCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATGAACCGCACAACGGGTATT
TCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACCGGCAGTGGCGCTACCGTT
TATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGTCTGGAAAAACTGATCTTC
ACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGCAAACCAAACTGGGGCCGG
TGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGATCCCGATGTCATCACCGCC
AAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGATGATCCTATGTATAAAGAA
ATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGTTGCGTTTTGAAGTATGGG
GCTTGCGACAAGGAAGGCTCGGATGA
 Primer design