SecReT6
Protein ID: 145600378
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3123
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3551224..3551589 [-]
Producthypothetical protein
NotePAAR
UniProt IDA4TQB9
KEGG IDypp:YPDSF_3123
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.70E-20, Aligned region: 18..107
PAAR_motif [PF05488], Evalue: 0.0028, Aligned region: 66..120
Protein Sequence: 121 a.a.     [Download]
>gi|145600378|ref|YP_001164454.1| hypothetical protein YPDSF_3123 [Yersinia pestis Pestoides F]
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGT
HSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>ref|NC_009381.1|:c3551589-3551224 hypothetical protein YPDSF_3123 [Yersinia pestis Pestoides F]
ATGACAGCAGCCAATACTCGCGCAGGTGGGATCAGCTTTATCGGCAGTGACCCGATGATCCCGATATCTG
CTCCCAACACCGCGCCCAACGCCAATGGTATTCCTAATGTCAGCAACTATTTTTGCTGTGGGGGTAACGA
ACAGAATCTCAACACCATCCGTCCAGCCACGATAGACGGCGGATCTGTGATGGGGGCGGCCTCGGGGACA
CATTCGGCCAAGATGGACCCTATGCAGGGATCAGGAAAGTATTTCATTCAGGGAAGCCCAGCAACACGTT
TAGGAGATATGAGTATGACCAATAATTACAACGCGCCTTCGACGCAAATTGCGCCCAGCCAGACCAAGTA
TTTTGTCAATGCGTAG
 Primer design