SecReT6
Protein ID: 145600382
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3127
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3555566..3557914 [-]
Producthypothetical protein
NoteTssI
UniProt IDA4TQC3
KEGG IDypp:YPDSF_3127
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 535..589
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 637..669
Phage_base_V [PF04717], Evalue: 2.30E-23, Aligned region: 365..457
Protein Sequence: 782 a.a.     [Download]
>gi|145600382|ref|YP_001164458.1| hypothetical protein YPDSF_3127 [Yersinia pestis Pestoides F]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFF
TYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLR
EYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGI
QRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAI
QSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDV
VYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNR
GNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTG
SSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTG
SSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVG
VDLKTVGMQSKN
 
Nucleotide Sequence: 2349 bp     [Download]
>ref|NC_009381.1|:c3557914-3555566 hypothetical protein YPDSF_3127 [Yersinia pestis Pestoides F]
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGC
AGGAAAAAGTGTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGATCTCGATCTGGT
CAGTTTGCTGGGGGAAATCATCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTT
ACCTATGTGATCGCCGGTGCTGATGAAGGGCAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTA
CCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGATATTTCAGGACCTGAATATTATCGATATTAT
CGAACAGGTATTCTCCAAATATAACTTTGCGGATTACCGTTTTGATATCGTCGGTAACTATCGATTACGC
GAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGACGAAGGCGTTT
GGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATA
CAGCGTATTCAACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATC
CACGCAATACATTACAAACCCATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTGCCACTGGAATGGTA
TGACTACGCGGCGGGTTACACCGATCCCCAGCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATA
CAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCACAGGATTAGTGCCAGGGCGCTCTTTTGCTC
TGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGTTGTGACTACAGTTTTGTCCA
GGATGGGCCGGACAGTGCGAGCCAGGGACGTAATGTCGCCTGTAAGTTTAAGGCATTGAATGATGACGTC
GTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAA
AACCACCGAAGATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTC
CTGGCGATGCCTCGGGTCGGGCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGG
TGACCGGGATCGTCTACAACGGTGAGAACCCACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGG
TTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACACGCCAGCCAGCTTACCTTCGATGATAATCGG
GGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGTTGAACGTAACAGTGCGACGG
CCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACCATATCTCCTA
CAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGGGA
CCTCCTTTACGGGGGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCT
AACCGGTGTCAGCAACTCGATGACCGGGTGTAGTTCCTCCTTTACCGGTACTAGCAATAGCATGACAGGC
AGTAGCCATAGCATGACCGGCATGAGCACCAGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTA
GCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAGCGTCAGCAGTACGGGCAGCAGCGTCAGTAC
GACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTTGTAGCGTCAGTACTACGGGT
AGCAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACGGGATGCAGTA
TTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGT
GTCGATCTGAAAACCGTTGGCATGCAAAGCAAAAACTGA
 Primer design