SecReT6
Protein ID: 145600384
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3129
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3560624..3561607 [-]
Producthypothetical protein
NoteTssG
UniProt IDA4TQC5
KEGG IDypp:YPDSF_3129
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-66, Aligned region: 18..312
Protein Sequence: 327 a.a.     [Download]
>gi|145600384|ref|YP_001164460.1| hypothetical protein YPDSF_3129 [Yersinia pestis Pestoides F]
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQT
LNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHV
AVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEAR
KGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRH
RMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 984 bp     [Download]
>ref|NC_009381.1|:c3561607-3560624 hypothetical protein YPDSF_3129 [Yersinia pestis Pestoides F]
ATGGCTAGCCTCCAGACGCTGAAAAACACGTTTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGT
TGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCT
GCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACG
CTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATG
GCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGA
ACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTC
GCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGC
CGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAG
AGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGT
AAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTA
TTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATA
TCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCAT
CGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAA
CGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTAC
CTAG
 Primer design