SecReT6
Protein ID: 145600386
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3131
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3563477..3563920 [-]
Producthypothetical protein
NoteTssE
UniProt IDA4TQC7
KEGG IDypp:YPDSF_3131
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-14, Aligned region: 23..123
Protein Sequence: 147 a.a.     [Download]
>gi|145600386|ref|YP_001164462.1| hypothetical protein YPDSF_3131 [Yersinia pestis Pestoides F]
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNYGLPSLSQQVP
VITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYS
YGMVRVL
 
Nucleotide Sequence: 444 bp     [Download]
>ref|NC_009381.1|:c3563920-3563477 hypothetical protein YPDSF_3131 [Yersinia pestis Pestoides F]
ATGGATATTTCAGCACCGATACTTTTTGACAAATTAAGTCTCCGCCATGAACACGTTCGCTTACCTCATT
GGCGTGAAGTGATTGTGCGCGATATTGAATCTTTATTGAATGACTCCGCACACAGTGCCCGGTTGAAGCT
AAAAAAGTATCCGCATTGTGAGGCTTCTGTATTGAATTACGGGCTGCCTTCGCTCAGTCAGCAGGTACCG
GTAATCACCGACTTGCTGGAACTGGCCAGACATATACAGCGGATCATCGCCACGTTTGAGTCACGCCTGG
ATCCGCGCTCAATAAAAGTGGTGCCGCTGATTAATAAAGGCGAAACCTGGGTGTTAGCCATCCTGTTTGA
CATTCATGCCCGGTGCAACCTACCGGGCGAAGAGCACTTGGTCAATTTACGCATCGCGCTCGATTACTCC
TATGGAATGGTTCGCGTTCTTTAA
 Primer design