SecReT6
Protein ID: 145600387
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3132
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3563994..3564512 [-]
Producthypothetical protein
NoteTssD
UniProt IDA4TQC8
KEGG IDypp:YPDSF_3132
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 8..148
Protein Sequence: 172 a.a.     [Download]
>gi|145600387|ref|YP_001164463.1| hypothetical protein YPDSF_3132 [Yersinia pestis Pestoides F]
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEFRMVSNKASPK
LFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNF
ARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
 
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_009381.1|:c3564512-3563994 hypothetical protein YPDSF_3132 [Yersinia pestis Pestoides F]
ATGGCAGCTTTAGTCGATTACTTTCTCCATATCGAAGGTGTAGATGGTGAGTCTCCCGATCAGCAGTATA
ACGGATGGATCCAAGTACAGGCTTGGCAATGGGCGGAGGAGAATGCGGGGCGCTGGGGGCTAGGTGGCGG
TGGTGGTTCTGGGAAAGTCGAAATGAAGGACTTCGAATTTCGCATGGTGAGTAACAAAGCATCACCAAAA
CTATTTTTGATGTGTGCCATCGGTGAACACATTCCGCAGGCCAAGTTGGTGTGTCGTAAATCAGGTCAAG
GTCAACAAGACTTCCTGATTGTTACCTTCAGTAACTGTCTGGTGTCCTCCTTTAAAACTGTCGGCAACAT
GCCTCTTGGTAAAGGGGACGCAGTATTCACCGACACGGTGCTGCCAACGGATGCCATCAGCCTTAACTTT
GCACGTATCGAAGTGGAATACAAAGAGCAGCAACCTGATGGCTCGATGGGGGCCGTGATTAAGGCTGGTT
ACGATCTGAAATTGAACAGCCGTATTTAA
 Primer design