SecReT6
Protein ID: 145600388
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3133
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3564675..3566186 [-]
Producthypothetical protein
NoteTssC
UniProt IDA4TQC9
KEGG IDypp:YPDSF_3133
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-184, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|145600388|ref|YP_001164464.1| hypothetical protein YPDSF_3133 [Yersinia pestis Pestoides F]
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIE
SLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAW
DQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWR
ELGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFT
WANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNA
GFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRL
VSKLPSNKESEKK
 
Nucleotide Sequence: 1512 bp     [Download]
>ref|NC_009381.1|:c3566186-3564675 hypothetical protein YPDSF_3133 [Yersinia pestis Pestoides F]
GTGGAGAACATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGT
TAGATGACATTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCAT
AGGCACGCTTGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAG
TCTTTAGTCGCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCC
AAAAGCTGGAATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAA
AATACGGGTACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGG
GATCAAAGTCCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTT
GCATGATCGGTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGT
GGCCGCCGCCGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGG
GAGCTGGGTAACCCAAGGGATATCGGCAAAATCTTTACCACACCTGAATATGCGCCATGGAGACGTTTAC
GTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGC
CAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACC
TGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAA
GGATCCGCGGTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGG
CGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCT
GGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATG
CACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTT
TGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGG
GATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAG
AAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGG
TTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTG
GTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA
 Primer design