SecReT6
Protein ID: 145600390
SecReT6 ID204
T6SS typei3
Gene symbol-
Locus tagYPDSF_3135
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]3566757..3567755 [-]
Producthypothetical protein
NoteTssA
UniProt IDA4TQD1
KEGG IDypp:YPDSF_3135
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 49..106
ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 178..198
Protein Sequence: 332 a.a.     [Download]
>gi|145600390|ref|YP_001164466.1| hypothetical protein YPDSF_3135 [Yersinia pestis Pestoides F]
MDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCFDLRVM
LWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTE
EHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESY
QLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEY
FQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 999 bp     [Download]
>ref|NC_009381.1|:c3567755-3566757 hypothetical protein YPDSF_3135 [Yersinia pestis Pestoides F]
ATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATGATCCGGCCTATGGCG
AGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCCGCATGAACCCCCTCA
AATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAGCAATGTTTTGATTTACGTGTAATG
CTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATATCGGCCCTCTATGATGGCTTTATGCGCATTA
ATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCCATTAAATAGTGGGCA
TGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACTGCACGCCTTACAGAA
GAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCCAAGAGAGATATTTTG
TTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATTGCCAGATTTAAAAGA
CCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAATCCACAGAGAGTTAC
CAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTGCACAATTGAATGCCC
CAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCTTGATACTCAGTCCTT
TAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGACCGTATTCTAGAGTAC
TTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAGAGATGATAGGTATGG
ATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACAGTTTACCGGAAAAAC
TAACCTACCGTTTCGATGA
 Primer design