SecReT6
Protein ID: 146305139
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0098
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]95546..97078 [+]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDA4XNF6
KEGG IDpmy:Pmen_0098
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.30E-70, Aligned region: 203..370
Sigma54_activ_2 [PF14532], Evalue: 1.30E-25, Aligned region: 204..374
HTH_8 [PF02954], Evalue: 1.10E-12, Aligned region: 463..503
AAA_5 [PF07728], Evalue: 1.40E-07, Aligned region: 54..83
AAA_5 [PF07728], Evalue: 1.40E-07, Aligned region: 226..340
GAF_2 [PF13185], Evalue: 1.50E-05, Aligned region: 37..173
GAF_2 [PF13185], Evalue: 1.50E-05, Aligned region: 272..295
HTH_30 [PF13556], Evalue: 8.20E-05, Aligned region: 459..471
HTH_30 [PF13556], Evalue: 8.20E-05, Aligned region: 472..504
AAA_2 [PF07724], Evalue: 0.0031, Aligned region: 224..326
AAA [PF00004], Evalue: 0.0051, Aligned region: 227..345
Protein Sequence: 510 a.a.     [Download]
>gi|146305139|ref|YP_001185604.1| unnamed protein product [Pseudomonas mendocina ymp]
MSSLNPSLMFSQIPQPLRYAEALLQRFAQLARHASADALLGGLVEAAAQLSASELSQLYLLDATHTRLTL
SAEWQDGQLQRRAEASLPSDYDGEQLLQYCLCQNQLLSLTELDSSLHSIGFLPESGQPWRSLLCQPLLDE
HRQVNGLLLIASHKPRELQGFAGSLGQLGGFAIAQLHLLQRLRAPQSEAATQPTPSCASGYGLIGDSPAM
RNVYQLIGKVLHNSVSVLLTGETGTGKELVARAIHDCGSRRSKAFVVQNCASLPENLLESELFGYRKGAF
SGADRDHQGLFDAANGGTLFLDEIGDMPLSLQAKLLRVLQEGEVRPLGSTRTHKVDVRIVSATHHNLRSL
VEEGRFREDLFYRLSHFPIELPPLRARGEDILRLARHFAVEAACFLQRDAYRWSEAALEHLAGYAFPGNV
RELKGLIARAVLLCEGGELLPEHFSLEQTPSEGSAPLSLRERMDRVERNLLLDCLRKNRGNQTNAANELG
LPRRTLLYRMQRLKISPSEV
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|146305042|ref|NC_009439.1|:95546-97078 Pseudomonas mendocina ymp chromosome, complete genome
GTGAGTTCGCTTAACCCCTCGCTGATGTTCAGCCAGATCCCCCAGCCGCTGCGCTATGCCGAGGCGCTGT
TGCAGCGCTTCGCCCAACTGGCCCGCCATGCCAGCGCCGACGCTCTGCTCGGCGGGCTGGTGGAAGCCGC
CGCGCAGCTGTCTGCCAGCGAGCTGAGCCAGCTGTACCTGCTCGACGCCACCCACACCCGCCTGACCCTC
AGCGCCGAGTGGCAGGACGGCCAACTGCAACGCCGTGCCGAGGCCAGCCTGCCCAGCGACTATGACGGCG
AACAGTTGCTGCAGTACTGCCTGTGCCAGAACCAGCTGCTCAGCCTCACCGAGCTGGATAGCAGCCTGCA
CAGCATCGGCTTCCTCCCGGAAAGCGGCCAGCCCTGGCGCAGCCTGCTGTGCCAGCCGCTGTTGGACGAA
CACCGGCAGGTCAATGGCTTGCTCCTCATCGCCAGCCACAAGCCCCGCGAGCTGCAGGGCTTCGCCGGAT
CCCTGGGTCAGCTCGGCGGCTTCGCCATTGCCCAGTTGCACCTGCTGCAGCGCCTGCGAGCACCGCAGAG
CGAGGCCGCAACACAACCGACTCCAAGCTGCGCCAGCGGCTACGGTCTGATCGGCGACAGCCCGGCGATG
CGCAACGTGTACCAGCTGATCGGCAAGGTCCTGCACAACTCGGTCAGCGTTTTGCTGACGGGCGAAACCG
GTACCGGCAAGGAGCTGGTGGCGCGTGCTATCCATGACTGTGGCTCCCGTCGCAGCAAAGCCTTCGTGGT
GCAGAACTGCGCCTCGTTGCCGGAAAACCTGCTGGAAAGTGAGCTGTTCGGCTACCGCAAGGGCGCCTTC
AGCGGCGCCGACCGCGACCATCAGGGCCTGTTCGATGCGGCCAATGGCGGCACCCTGTTCCTCGATGAAA
TCGGCGATATGCCGCTGAGCCTGCAAGCCAAGCTGCTGCGCGTGCTGCAGGAGGGTGAAGTGCGCCCGCT
CGGTTCGACCCGCACGCACAAGGTCGATGTGCGCATCGTCTCGGCCACGCACCACAATCTGCGCAGCCTG
GTCGAGGAAGGCCGCTTTCGCGAAGACCTGTTCTATCGCCTGTCGCACTTCCCCATCGAGCTGCCGCCAC
TGCGCGCCCGCGGTGAGGACATCCTGCGCCTGGCGCGGCACTTCGCCGTCGAGGCCGCGTGCTTCCTGCA
GCGCGATGCCTATCGCTGGTCGGAAGCGGCGCTGGAGCACCTGGCCGGTTACGCCTTCCCCGGCAACGTG
CGCGAACTCAAGGGCCTGATCGCGCGCGCCGTGCTGCTGTGCGAGGGCGGCGAGCTGCTGCCCGAGCATT
TCAGCCTGGAGCAGACGCCGAGCGAAGGCAGCGCACCGCTGAGCCTGCGCGAGCGCATGGACCGGGTCGA
ACGCAATCTGCTGCTCGACTGCCTGCGCAAGAACCGCGGCAACCAGACCAATGCCGCCAACGAGCTGGGC
CTGCCCCGGCGCACCCTGCTGTACCGCATGCAGCGGCTGAAGATCAGCCCGAGCGAGGTCTGA
 Primer design