SecReT6
Protein ID: 146305145
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0104
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]101174..104713 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4XNG2
KEGG IDpmy:Pmen_0104
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.90E-77, Aligned region: 502..793
IcmF-related [PF06761], Evalue: 1.90E-77, Aligned region: 950..1017
ImcF-related_N [PF14331], Evalue: 3.60E-73, Aligned region: 197..455
DUF1215 [PF06744], Evalue: 7.30E-37, Aligned region: 914..1038
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 135..266
AAA_33 [PF13671], Evalue: 0.0035, Aligned region: 460..488
Protein Sequence: 1179 a.a.     [Download]
>gi|146305145|ref|YP_001185610.1| unnamed protein product [Pseudomonas mendocina ymp]
MKSFFAKLGAFFRKTWVWSLLLVLVLALLVWFVGPLLAVDDYKFWESATSRLLTISLLFLLWGLAMVFAS
WRATARKKAEENDAEAQERLRREEQIGEEQNELRHRFKDALRTLKRSSLYRGRSEKWRNDLPWYLLLGPQ
GSGKTSLLDFSGLDFPLNRGDSQRLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAQVDGRAWGTLLG
LLRQRRARPLNGVLVSIPVEQLQGGSEVELETLARQTRQRLHEIHQRLGADVPVYLVLSKADKVLGFDEF
FDQLSREESEQVLGASFRKEQNASDVAVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQI
GERLCLFIELAFAGNRYQRASKLRGFYLTSAPQLNEQLDPLTAGIGRNLGLAGSALPTFRTGRARFINHL
LSRVIFPEADLAGLDQKEVRRIDWGQRAMYATAFAVLALFGVLWASGFSANHGRLEQLREIAQKLTREHQ
AINPQDDALQTLKALDSSYAATLVFPPKGEVSYLQRTGLFQGEAVNPAVYSTYRAELETLLLPRVARQLE
AQIRANLGDRERLLGSLRAYLMLNLEQRRDAAFLKEWVAADWSLRYAGNSPAQHGLNTHFARLLDESFAP
YALNAQLVAQARQVLRSESLANVVYRMLREQARSLPDYRLSQKLGPQAGLINGSDYAIPGFYTQAGYSKT
FTAQGGNLVREILRDNWVLGEGESLSAGDLGRLMVELEQLYFRDYGNYWGEAIAQLSLEPIGSAGRGAAL
LGGLTAANSPLLQLLVEVRDNTRFKGLAEAADDAGAAAEALEGAKGKLGKAAKLASAAAEQAQQALAKNT
PDTARKTLERRFEVLHKLLDDNGGAGVELAASLQALDELQRQLASLANAGASDQAAFEMAKARMAGKRDA
INQVRSAAARLPQPVGNWLALLAEDSWTLVLNDAYHFLNQRYQSELYAAYDNSLKQRYPFSAHSESDVAV
ADFREFFKAQGIAERFFDQYLRPFVSGSADEYRLRRVDGRGLPLSREFLLQMSRAQVIRRSFFAENPAEP
QVLFKLEPYSLDSSLSRADFRFGKQQLEYRHGPIVATAFRWPAASEEDRTSLVVEELGGRRVGIEKNTGP
WSLFRLLDLMDVDYHSGRDVLILKANLGGLHANYLLHSQRSPNPFDIGLLRSFKLPATL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|146305042|ref|NC_009439.1|:101174-104713 Pseudomonas mendocina ymp chromosome, complete genome
ATGAAGAGCTTCTTCGCCAAACTTGGCGCCTTTTTCCGCAAGACCTGGGTCTGGAGCCTGCTGCTGGTGC
TGGTCCTCGCCCTGCTGGTGTGGTTCGTCGGCCCGCTGCTGGCGGTCGACGACTACAAGTTCTGGGAGTC
GGCCACCAGCCGCCTGCTGACCATCAGCCTGCTGTTCCTGCTCTGGGGCCTGGCCATGGTGTTCGCCAGC
TGGCGCGCCACCGCACGCAAGAAGGCCGAGGAGAACGACGCCGAGGCGCAGGAGCGCCTGCGCCGCGAGG
AGCAGATCGGCGAGGAGCAGAATGAGCTGCGCCACCGCTTCAAGGACGCCCTGCGCACCCTCAAGCGCTC
CAGCCTGTACCGCGGGCGCAGCGAGAAGTGGCGCAACGATCTGCCCTGGTACCTGCTGCTCGGCCCGCAG
GGCAGCGGCAAGACCAGCCTGCTGGACTTCTCCGGCCTGGACTTCCCGCTCAACCGCGGCGACAGCCAGC
GCCTGACCAAGGACGTCTCCGGCACCCGTTATGCCGACTGGTACTTCGCCGATCACGCCGTGCTGATCGA
CACCGCCGGGCGCTACCTGACCCAGCCAGACGCGCAGGTCGACGGCCGCGCCTGGGGCACCCTGCTCGGC
CTGCTGCGTCAGCGCCGCGCGCGCCCGCTCAACGGCGTGCTGGTGAGCATTCCGGTGGAGCAGCTGCAGG
GCGGCAGCGAGGTGGAGCTGGAAACCCTGGCCCGCCAGACCCGCCAGCGCCTGCACGAGATCCATCAGCG
CCTGGGCGCCGACGTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACAAGGTGCTGGGCTTCGACGAGTTC
TTCGACCAGCTGTCGCGCGAGGAGAGCGAGCAGGTGCTCGGCGCCAGCTTCCGCAAGGAGCAGAACGCCA
GCGACGTGGCCGTGGTGCGCCAGGAGTTCGAAGAACTGCTGCGCCGCCTCAACAGCCAGGTGATCCTGCG
CATGCACCAGGAGCGTGATACCCAGCGCCGTGGCCGCATCCTCGACTTCCCGCACCAGCTCGGCCAGATC
GGCGAGCGCCTGTGCCTGTTCATCGAACTGGCCTTCGCCGGCAACCGTTACCAGCGCGCCAGCAAGCTGC
GCGGTTTCTACCTGACCAGCGCACCGCAGCTCAACGAACAGCTCGACCCGCTCACCGCCGGCATCGGCCG
CAACCTCGGCCTGGCCGGCAGCGCGCTGCCGACCTTCCGCACGGGCCGTGCACGCTTCATCAACCACCTG
CTCAGCCGGGTGATCTTCCCCGAGGCCGACCTGGCCGGACTCGACCAGAAGGAAGTGCGCCGCATCGACT
GGGGCCAGCGCGCCATGTATGCCACCGCCTTCGCCGTGCTGGCGCTGTTCGGCGTGCTCTGGGCCAGCGG
CTTCTCGGCCAACCACGGGCGCCTGGAACAGCTGCGCGAGATCGCCCAGAAGCTCACCCGCGAGCACCAG
GCGATCAACCCGCAGGACGACGCCCTGCAGACCCTCAAGGCGCTGGACAGCAGCTACGCCGCCACCCTGG
TGTTCCCGCCCAAGGGCGAGGTGTCCTACCTGCAGCGTACCGGCCTGTTCCAGGGCGAGGCGGTCAATCC
GGCCGTTTATTCGACCTACCGCGCCGAGCTGGAAACCCTGCTGCTGCCTCGCGTGGCGCGGCAGCTGGAG
GCGCAGATCCGCGCCAACCTCGGCGACCGCGAGCGCCTGCTCGGCAGCCTGCGCGCCTACCTGATGCTCA
ACCTGGAACAGCGCCGCGACGCCGCCTTCCTCAAGGAGTGGGTAGCCGCCGACTGGTCGCTGCGCTATGC
CGGCAACAGCCCGGCGCAGCATGGCCTCAACACCCATTTCGCCCGTCTGCTCGACGAGTCCTTCGCGCCC
TATGCGCTCAACGCCCAGCTGGTCGCCCAGGCGCGCCAGGTGCTGCGCAGCGAGTCGCTGGCCAATGTGG
TCTATCGCATGCTGCGCGAACAGGCGCGCAGCCTGCCGGACTACCGTCTGAGCCAGAAGCTCGGGCCGCA
GGCCGGGCTGATCAATGGCAGCGACTACGCCATCCCCGGCTTCTACACCCAGGCCGGCTACAGCAAGACC
TTCACCGCCCAGGGCGGCAACCTGGTGCGCGAGATCCTGCGCGACAACTGGGTGCTGGGCGAGGGCGAGA
GCCTCAGCGCCGGCGACCTCGGCCGCCTGATGGTAGAGCTGGAGCAGCTGTACTTCCGCGATTACGGCAA
CTACTGGGGCGAGGCCATTGCCCAGCTCAGCCTGGAGCCGATCGGCAGTGCCGGCCGTGGTGCTGCCCTG
CTCGGCGGCCTGACCGCGGCCAACTCGCCGCTGCTGCAACTGCTGGTGGAAGTGCGCGACAACACCCGCT
TCAAGGGCCTGGCCGAGGCCGCCGATGACGCCGGTGCCGCCGCCGAAGCGCTGGAGGGCGCCAAGGGCAA
GCTGGGCAAGGCCGCCAAGCTGGCCAGCGCTGCCGCCGAACAGGCGCAGCAGGCCCTGGCCAAGAACACC
CCGGACACCGCGCGCAAGACCCTGGAACGCCGCTTCGAGGTGCTGCACAAGCTGCTCGACGACAACGGCG
GCGCCGGCGTCGAACTGGCCGCCAGCCTGCAGGCATTGGACGAACTGCAGCGCCAGCTGGCCAGCCTGGC
CAATGCCGGTGCCAGCGACCAGGCCGCGTTCGAGATGGCCAAGGCGCGCATGGCCGGCAAGCGCGATGCG
ATCAACCAGGTACGCAGCGCCGCCGCGCGCCTGCCGCAGCCGGTGGGCAACTGGCTGGCGCTGCTGGCCG
AGGACAGCTGGACGCTGGTGCTTAACGACGCCTACCACTTCCTCAACCAGCGCTATCAGAGCGAGCTGTA
CGCCGCCTACGACAACTCGCTGAAGCAGCGTTACCCGTTCAGCGCGCACAGCGAGAGCGACGTGGCGGTG
GCGGATTTCCGCGAGTTCTTCAAGGCCCAGGGCATCGCCGAGCGCTTCTTCGACCAGTACCTGCGCCCCT
TCGTCAGCGGCAGCGCCGACGAATACCGCCTGCGCCGCGTCGATGGCCGCGGCCTGCCGCTGTCGCGCGA
GTTCCTCCTGCAGATGAGCCGCGCCCAGGTGATCCGCCGCAGCTTCTTCGCCGAGAACCCGGCCGAGCCG
CAGGTGCTGTTCAAGCTCGAGCCCTACTCGCTGGACTCCAGCCTGAGCCGCGCCGACTTCCGCTTCGGCA
AGCAGCAGCTGGAGTACCGTCACGGTCCGATCGTCGCCACCGCCTTCCGCTGGCCGGCGGCGAGCGAGGA
AGACCGCACCAGCCTGGTGGTCGAGGAGCTTGGCGGTCGCCGCGTCGGCATCGAGAAGAACACCGGCCCC
TGGTCGCTGTTCCGCCTGCTCGACCTGATGGACGTGGACTACCACAGCGGTCGTGACGTGCTGATCCTCA
AGGCCAACCTGGGCGGCCTGCACGCCAACTACCTGCTGCACAGCCAGCGCTCGCCGAACCCGTTCGACAT
CGGCCTGCTGCGCAGCTTCAAGCTGCCGGCGACGCTCTGA
 Primer design