SecReT6
Protein ID: 146305146
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0105
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]104713..105441 [+]
Productprotein phosphatase 2C domain-containing protein
NoteStp1
UniProt IDA4XNG3
KEGG IDpmy:Pmen_0105
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 4.00E-17, Aligned region: 20..205
PP2C [PF00481], Evalue: 6.10E-13, Aligned region: 31..206
SpoIIE [PF07228], Evalue: 6.30E-11, Aligned region: 36..241
Protein Sequence: 242 a.a.     [Download]
>gi|146305146|ref|YP_001185611.1| unnamed protein product [Pseudomonas mendocina ymp]
MPAVVNAWRSAARTDTGKVRARNEDAFLALPEQGLWVVADGMGGHQNGALASRLIVEQLAELAQGSLEQR
LVELRQALHRLNHRLGQELTVTADRPDTVIGSTVVALLLDGDRAACVWAGDSRCYLWRGARLYQLSRDHS
LVQQLIDEQGLTPQEAARHPAAHALTRAIGASETLQLDILELDVLPGDVFLLCSDGLYQGVSADELGACL
NLPSPHLAVERLFQRVLDGPARDNLSAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|146305042|ref|NC_009439.1|:104713-105441 Pseudomonas mendocina ymp chromosome, complete genome
ATGCCGGCAGTCGTCAACGCCTGGCGCAGCGCCGCGCGCACCGACACCGGCAAGGTGCGCGCGCGCAACG
AGGATGCCTTCCTGGCCCTGCCCGAGCAGGGCCTGTGGGTGGTGGCCGACGGCATGGGCGGGCACCAGAA
CGGCGCCCTGGCCAGCCGCCTGATCGTCGAGCAGCTGGCCGAGCTGGCGCAGGGCAGCCTGGAGCAGCGT
CTGGTGGAGCTGCGTCAGGCGCTGCACCGGCTCAATCATCGCCTCGGTCAGGAGCTGACGGTGACCGCCG
ACCGCCCGGACACGGTGATCGGCAGCACCGTGGTCGCCCTGCTGCTCGACGGCGACCGCGCCGCCTGCGT
CTGGGCCGGTGATAGCCGCTGCTACCTGTGGCGCGGTGCGCGTCTGTATCAGCTCAGCCGCGACCATTCA
CTGGTGCAGCAACTGATCGACGAACAGGGCCTGACGCCGCAGGAGGCCGCGCGCCACCCGGCGGCGCATG
CCCTGACCCGCGCCATCGGCGCCAGCGAGACCCTGCAGCTGGACATCCTCGAACTCGACGTGCTGCCCGG
CGACGTCTTCCTGCTGTGCAGCGACGGCCTCTACCAGGGCGTTTCCGCCGACGAGCTGGGCGCCTGCCTC
AACCTGCCTTCGCCGCACCTGGCCGTGGAGCGCCTGTTCCAGCGCGTGCTCGACGGCCCGGCCCGTGACA
ACCTCAGCGCCGTGGTGATCCGCCAATGA
 Primer design