SecReT6
Protein ID: 146305147
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0106
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]105438..106409 [+]
Productprotein kinase
NoteStk1
UniProt IDA4XNG4
KEGG IDpmy:Pmen_0106
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 5.50E-34, Aligned region: 43..297
Pkinase_Tyr [PF07714], Evalue: 2.30E-22, Aligned region: 45..297
APH [PF01636], Evalue: 0.0018, Aligned region: 131..192
APH [PF01636], Evalue: 0.0018, Aligned region: 218..289
Protein Sequence: 323 a.a.     [Download]
>gi|146305147|ref|YP_001185612.1| unnamed protein product [Pseudomonas mendocina ymp]
MIEAAEASDLTYFALAATAAREPVRETPRQAPGELPEVLGGRYRIERLLGVGGMGAVYRARDLLREQFGD
PEPYVALKTLSDDFAEYPDANALLYSEFALTARLSHPNVVRLFGFEVDIPSQRAFITLELLRGLTLDQLL
CERPEGLPWDELRGIAIPLLEALCYSHQLGVLHGDLKPSNVMLAEDGLRLFDYGLGQPVEGLLPGLPRLC
RSRIAAWTPRYAALELLEGAPLSAAADVYALACVLVELASGQHPFRRLSAKQAKSMELDRQLQRPAQVPL
HCWQALRTALAFDESQRQIDCSELLDAFRRPPASRLRRWLGKA
 
Nucleotide Sequence: 972 bp     [Download]
>gi|146305042|ref|NC_009439.1|:105438-106409 Pseudomonas mendocina ymp chromosome, complete genome
ATGATCGAAGCCGCCGAAGCCAGCGACCTCACCTACTTCGCCCTGGCCGCCACCGCCGCCAGGGAACCCG
TGCGCGAAACGCCGCGCCAGGCTCCCGGCGAGCTGCCGGAAGTGCTCGGCGGCCGCTACCGGATCGAGCG
TCTGCTCGGCGTCGGCGGTATGGGCGCGGTGTATCGCGCGCGCGATCTGCTGCGCGAACAGTTCGGTGAC
CCCGAGCCCTATGTCGCGCTGAAGACCCTGAGCGACGACTTCGCCGAATACCCGGACGCCAACGCCCTGC
TCTACAGCGAGTTCGCCCTTACCGCGCGGCTCAGCCACCCCAACGTGGTGCGTCTGTTCGGTTTCGAGGT
GGACATTCCCAGCCAGCGCGCCTTCATCACCCTGGAACTGCTGCGCGGCCTGACCCTCGATCAGCTGCTC
TGCGAACGCCCCGAGGGCCTGCCCTGGGACGAGCTGCGTGGCATCGCCATCCCGCTGCTCGAAGCCCTGT
GCTATTCGCACCAGCTGGGCGTGCTGCATGGCGATCTCAAGCCCAGCAATGTGATGCTGGCCGAAGACGG
CCTGCGCCTGTTCGACTATGGTCTCGGCCAGCCGGTGGAGGGCCTGCTGCCCGGTCTGCCACGCCTGTGC
CGCAGCCGCATCGCCGCCTGGACACCGCGCTACGCCGCGCTGGAGTTGCTCGAAGGCGCGCCGCTGTCGG
CGGCTGCTGATGTCTATGCGCTGGCCTGCGTGCTGGTCGAGCTGGCCAGCGGGCAACACCCGTTCCGCCG
CCTCAGCGCCAAGCAGGCCAAGAGCATGGAGCTGGACAGGCAGTTGCAACGCCCGGCGCAGGTGCCGCTG
CACTGCTGGCAGGCCCTGCGCACCGCGCTGGCCTTCGACGAAAGCCAGCGGCAGATCGACTGCAGCGAGC
TGCTCGACGCGTTTCGCCGGCCACCGGCCTCGCGTCTGCGCCGCTGGCTGGGCAAGGCATAA
 Primer design