SecReT6
Protein ID: 146307341
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2316
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2554174..2557689 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4XUQ8
KEGG IDpmy:Pmen_2316
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.70E-99, Aligned region: 89..126
ImcF-related_N [PF14331], Evalue: 4.70E-99, Aligned region: 191..452
IcmF-related [PF06761], Evalue: 6.90E-89, Aligned region: 502..798
DUF1215 [PF06744], Evalue: 9.50E-39, Aligned region: 910..1030
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 126..252
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 276..336
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 410..440
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 611..645
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 773..843
Protein Sequence: 1171 a.a.     [Download]
>gi|146307341|ref|YP_001187806.1| unnamed protein product [Pseudomonas mendocina ymp]
MKAFFNFCVRWLVPILGLIALSLVIWFVGPLIAIGGFEPLASASVRWILIALLFLIWIGFRVLRLIQTRR
NAAKVMQGLVAVAPDAASVATAEELATLKQRMDEALQLLKKAKLGGQERRNLYELPWYVIIGPPGSGKTT
ALVNSGLNFPLAEHMGGGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAEVDKAAWLGFLDLLKNQ
RKRRPIDGAFIAISLSDLLLGSESERAAHARSIRARVQELYAQLGVRFPIYVMLTKFDLVPGFMEFFDDL
GKEERGQVWGITFPLDDGKSGEGPLAGFKQEFAALEERLTQRLVERLQQERDPNRRDLIYGFPQQFAALR
DNLASFLDGVFKPNPYEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQTGTGRSYFIERL
FREVAFGERGLVGANPKVERRRKWITRGALAASVLLFVAVASVWLVSYNANQAYIAEVDARVAPLKGQLE
ALSPAQREVLAVLPLLNAIRHVADNPPSWAAGFGLYQGDMLGAEAGSVYRKLLIAVMAPRLLTRIEEQLR
SGGNSDFLYEGLKAYLMLASADQYDADFIKAWINLDWDQSLPRDLAPDQRLALGEHLDALFARKPPPARL
DENLIEDLRRQLQQMSVAQRVYNRVKRQKLPDGLPDFRISEAAGRDAALVFTRKSGKPLNDPLSGFYTYR
GYRQVFMVASLSQSGALAEEQWVLGRPLADNQDAATLALEVRNLYFQDFLGQWESLLGDIDFVAIISVAQ
AADVMRVLSGPNSPLKQLLEAVARETDLQQEDRLLADKLKAADGTVDKLKQQLGSLVGQGAQNQPQAAPQ
VDPITARFNELNSLVRKPEGSNSAPIDDLLAQFNELYVQLSAMSGASGDALLGEAKNQAVASAQRVKLAG
ERQPPLVQNLVNSVVSATTNSMMGGIRSQLNAAWVAEVVNVYRQSLAGRYPLDSGSTRDATLEDFGNFFG
VGGVMDNYFRKYLQPYVDTSATTWRWQPGAAERLGIGSGVLQTFQRAAAIRDAFFRSGGTQPTVRFELKP
VAMDAAISQFILDLDGQQMTYDHGPSRPVAMQWPSPNSLGVVRLSITPPTSAGRSGLTLDGPWAWFRLLE
QSDLTPGASPDRFTLRLRVDNASVACELRASSAFNPFRGRVLSGFSLPERL
 
Nucleotide Sequence: 3516 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2557689-2554174 Pseudomonas mendocina ymp chromosome, complete genome
GTGAAGGCCTTCTTCAATTTCTGTGTGCGCTGGCTCGTGCCGATTCTCGGTCTGATCGCCCTCAGCCTGG
TGATCTGGTTCGTCGGCCCGCTGATCGCCATCGGCGGCTTCGAGCCGCTGGCCTCGGCGTCCGTGCGCTG
GATTCTGATCGCGCTGCTGTTCCTGATCTGGATCGGCTTTCGCGTCCTGCGCCTGATCCAGACGCGACGC
AACGCCGCCAAGGTCATGCAGGGGCTGGTGGCCGTGGCGCCGGATGCCGCCAGCGTGGCCACCGCCGAGG
AGCTGGCGACCCTCAAGCAGCGCATGGACGAAGCCCTGCAACTGCTGAAGAAGGCCAAGCTCGGCGGCCA
GGAGCGGCGCAACCTCTACGAGCTGCCCTGGTACGTGATCATCGGGCCGCCCGGTTCGGGCAAGACCACC
GCGCTGGTCAACTCCGGGCTCAACTTCCCCCTGGCCGAGCATATGGGCGGCGGCGCCATCCGTGGCGTCG
GCGGCACGCGCAACTGCGACTGGTGGTTCACCGACGAGGCCGTGCTGCTGGATACCGCCGGCCGCTACAC
CACCCAGGACAGCCACGCCGAGGTGGACAAGGCCGCCTGGCTGGGCTTTCTCGACCTGCTCAAGAACCAG
CGTAAGCGCCGCCCCATCGACGGCGCATTCATTGCCATCAGCCTGTCCGACCTGCTGCTGGGCAGCGAGA
GCGAGCGCGCCGCCCATGCCCGTTCGATCCGCGCGCGGGTGCAGGAGCTCTACGCCCAACTCGGCGTGCG
TTTCCCCATCTACGTGATGCTGACCAAGTTCGACCTGGTGCCAGGCTTCATGGAGTTCTTCGACGACCTC
GGCAAGGAGGAGCGCGGTCAGGTCTGGGGCATCACCTTCCCCCTGGACGACGGCAAGAGCGGAGAAGGGC
CGCTGGCTGGCTTCAAGCAGGAGTTCGCCGCCCTCGAGGAGCGCCTGACCCAACGCCTGGTGGAGCGTCT
GCAGCAGGAGCGCGACCCCAACCGGCGCGACCTGATCTACGGCTTCCCGCAGCAATTCGCCGCGCTGCGC
GACAACCTCGCCAGCTTTCTCGACGGCGTGTTCAAACCCAATCCCTACGAGGAGCGGGTGCTGCTGCGCG
GCGTCTATTTCACCAGCGGCACGCAGGAAGGCAGCCCCATCGACCGCCTGATCGGTGCCATGGCGCAGAG
CATGAACCTCGACCGCCAGCACCTGGCGCGGCAGACCGGCACCGGGCGCAGCTACTTCATCGAGCGGCTG
TTTCGCGAGGTGGCCTTCGGCGAGCGCGGCCTGGTCGGCGCCAATCCCAAGGTGGAGCGCCGACGTAAGT
GGATCACCCGCGGCGCCCTGGCCGCTTCCGTGCTGCTGTTCGTCGCGGTCGCCAGCGTCTGGCTGGTCAG
CTACAACGCCAACCAGGCCTATATCGCCGAGGTCGACGCGCGGGTGGCGCCGCTCAAGGGCCAGCTGGAG
GCCCTGAGTCCGGCGCAGCGCGAAGTGCTGGCGGTGCTGCCGCTGCTCAACGCCATCCGCCACGTGGCGG
ACAACCCGCCGTCCTGGGCCGCCGGCTTCGGCCTTTACCAGGGCGACATGCTCGGCGCCGAAGCCGGCAG
CGTCTATCGCAAGCTGCTGATCGCGGTGATGGCGCCGCGGCTGCTGACCCGCATCGAGGAACAGCTGCGC
AGCGGCGGCAATTCCGACTTCCTCTACGAGGGGCTCAAGGCCTATCTGATGCTGGCCAGCGCCGACCAGT
ACGATGCGGACTTCATCAAGGCCTGGATCAACCTGGACTGGGACCAGAGCCTGCCGCGCGATCTGGCGCC
GGATCAGCGCCTGGCCCTCGGCGAGCACCTCGATGCGCTGTTCGCGCGCAAGCCGCCACCGGCGCGGCTG
GACGAGAACCTGATCGAGGACCTGCGTCGCCAGCTGCAGCAGATGTCGGTGGCGCAGCGCGTCTACAACC
GGGTCAAGCGACAGAAGCTGCCCGACGGTCTGCCGGACTTTCGCATCAGCGAAGCGGCCGGGCGCGACGC
CGCGCTGGTGTTCACCCGCAAGAGCGGCAAGCCGCTGAACGATCCACTGAGCGGCTTCTACACCTACCGC
GGCTATCGCCAGGTGTTCATGGTCGCCAGCCTCAGCCAGTCCGGCGCGCTGGCCGAGGAGCAGTGGGTGC
TGGGCCGACCGCTGGCGGACAACCAGGACGCCGCCACCCTGGCCCTGGAGGTACGCAACCTGTACTTCCA
GGATTTTCTCGGCCAATGGGAAAGCCTGCTCGGCGATATCGATTTCGTCGCCATCATCAGCGTGGCCCAG
GCGGCCGACGTGATGCGCGTGCTGTCCGGGCCCAATTCGCCGCTCAAGCAGCTGCTCGAGGCGGTGGCGC
GGGAAACCGACCTGCAGCAGGAAGATCGCCTGCTCGCCGACAAGCTCAAGGCCGCCGACGGCACGGTGGA
CAAGCTCAAGCAGCAGCTCGGCTCGCTGGTCGGCCAGGGGGCGCAAAACCAGCCGCAGGCCGCGCCCCAG
GTGGACCCGATCACCGCCCGCTTCAACGAGCTGAACAGCCTGGTGCGCAAGCCCGAGGGTAGCAACAGTG
CGCCCATCGACGACCTGCTGGCGCAGTTCAACGAACTCTACGTGCAGCTCAGCGCCATGAGCGGCGCCAG
TGGTGACGCCTTGCTCGGCGAGGCGAAGAATCAGGCGGTGGCCTCGGCGCAGCGGGTCAAGCTGGCCGGC
GAACGCCAGCCGCCGCTGGTGCAGAACCTGGTCAACTCGGTGGTCAGCGCCACCACCAACAGCATGATGG
GCGGCATCCGCAGCCAGCTCAACGCCGCCTGGGTGGCCGAGGTGGTCAACGTCTACCGCCAGTCGCTGGC
CGGCCGCTACCCGCTGGACAGCGGCAGTACGCGTGACGCCACGCTGGAGGACTTCGGCAACTTCTTCGGC
GTCGGCGGGGTGATGGACAACTACTTCCGCAAGTACCTGCAGCCCTACGTCGACACCTCGGCGACCACCT
GGCGCTGGCAGCCGGGGGCGGCCGAGCGCTTGGGGATAGGCAGCGGCGTGCTGCAGACCTTTCAGCGCGC
GGCGGCGATCCGCGATGCCTTCTTCCGCTCCGGCGGCACCCAGCCCACGGTGCGCTTCGAACTCAAGCCG
GTGGCCATGGACGCGGCGATCAGCCAGTTCATCCTCGATCTGGACGGCCAGCAGATGACCTACGACCACG
GCCCCAGCCGGCCGGTGGCCATGCAGTGGCCGAGCCCCAACAGCCTGGGCGTGGTGCGCCTGTCGATCAC
CCCGCCGACCAGCGCCGGGCGTTCCGGCCTGACCCTGGACGGGCCCTGGGCCTGGTTCCGCCTGCTCGAG
CAATCGGACCTGACCCCCGGCGCTTCGCCGGACCGTTTCACCCTGCGCCTGCGCGTGGACAACGCCAGCG
TGGCCTGCGAACTGCGCGCCAGCAGCGCCTTCAATCCCTTCCGTGGCCGTGTGCTGAGCGGCTTCAGCTT
GCCGGAGCGGTTATGA
 Primer design