SecReT6
Protein ID: 146312548
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2906
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3147681..3149096 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA4WCZ1
KEGG IDent:Ent638_2906
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 4.00E-52, Aligned region: 109..151
DUF3702 [PF12486], Evalue: 4.00E-52, Aligned region: 150..177
DUF3702 [PF12486], Evalue: 4.00E-52, Aligned region: 310..455
ImpA-rel_N [PF06812], Evalue: 4.60E-19, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 4.60E-19, Aligned region: 357..381
Protein Sequence: 471 a.a.     [Download]
>gi|146312548|ref|YP_001177622.1| ImpA domain-containing protein [Enterobacter sp. 638]
MNDITPRKIKTGGNPRMLPDYAALRDELSKLTHPARPDVDWRCVEKFCLSLFEQNGVELQTAAWYTLTRT
QLDGLFGLNEGLAILEALISHRWGTLWPQPVHARMEILSSLSQRLQQRMRSLPLNYCDLSQLYRAEKLLK
SLGEVLQRLELKHLSQFDTLRTLIHNSAARLENCDEITTLHSGSGLSARVMKGAAASTEAHTDSPLEENI
ASDSTVKWVYVAQPEPLAKVEGLAAMPTPVKKWKSFAAGMFTMLVISIVTVWAWQYLSRPDPLQIQLAAS
LAPITAALSPAQLDVLRQQSPLPQTVIAQTQQQIARLDKLPPDWNIARSRQLVDQAQVLWPEQAKLLAQQ
WQQQLNAAALPTEHLDGWHLGMTKLQQLSDRLNGLDEQKGKYMTVSELKSVVFSAMQSFNQSMPAEERLR
VLSQIPAGQPLPSAAKAQAEMHLKQLIARYALVAQSDDAQRSLIQLKTTDE
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3149096-3147681 Enterobacter sp. 638, complete genome
ATGAATGACATTACCCCGCGTAAAATAAAAACGGGCGGCAACCCACGCATGCTGCCGGATTACGCCGCCC
TGCGCGATGAACTGAGTAAGCTGACCCATCCTGCACGCCCGGATGTGGACTGGCGATGTGTGGAAAAATT
CTGTCTCTCCCTGTTTGAGCAAAATGGCGTCGAGCTGCAGACGGCGGCTTGGTATACGCTGACCCGTACG
CAACTGGACGGATTATTTGGTCTCAATGAAGGTCTGGCGATACTCGAGGCACTGATAAGTCATCGGTGGG
GGACACTGTGGCCGCAGCCCGTTCATGCCCGTATGGAAATCCTCAGCAGTCTGAGCCAGCGTTTGCAGCA
ACGGATGCGCTCGCTCCCGCTAAATTACTGCGATCTCAGCCAACTGTATCGCGCAGAGAAATTGCTTAAA
AGTCTGGGTGAGGTTTTGCAGCGCCTCGAGCTCAAACATCTGAGCCAATTCGATACGCTTCGTACCCTGA
TCCATAACAGTGCCGCCCGGCTGGAAAACTGCGATGAAATAACGACCTTGCATTCTGGTAGCGGGTTGTC
TGCGAGGGTGATGAAGGGGGCCGCAGCATCAACGGAGGCTCATACTGATAGTCCGCTCGAAGAGAATATC
GCGTCAGATAGCACCGTGAAGTGGGTTTACGTTGCGCAGCCAGAACCCCTGGCGAAGGTGGAAGGACTGG
CAGCAATGCCCACGCCGGTAAAAAAGTGGAAATCATTCGCGGCTGGGATGTTTACCATGCTGGTGATCAG
CATCGTAACGGTATGGGCTTGGCAGTATTTGTCCCGGCCAGACCCTTTACAGATTCAGCTTGCTGCATCA
CTGGCCCCGATCACCGCGGCGCTCTCGCCTGCACAATTGGATGTTCTGCGTCAGCAATCTCCGTTACCAC
AAACCGTCATTGCTCAAACACAGCAGCAGATTGCCCGACTGGATAAGTTGCCTCCTGACTGGAATATTGC
AAGGAGTCGACAGCTCGTGGATCAAGCTCAGGTGCTGTGGCCGGAGCAGGCAAAACTTCTGGCACAGCAG
TGGCAGCAACAACTTAATGCGGCCGCATTACCGACAGAACACCTTGATGGCTGGCATTTGGGAATGACGA
AGCTGCAACAGCTGAGTGATCGTTTGAACGGGCTCGATGAGCAGAAAGGTAAATACATGACGGTCAGCGA
ACTGAAATCTGTCGTTTTTTCCGCCATGCAGTCATTTAACCAATCGATGCCAGCGGAAGAACGGCTGAGA
GTATTGTCACAAATTCCTGCTGGGCAACCACTTCCGTCTGCTGCAAAGGCTCAGGCAGAGATGCATCTAA
AACAGCTTATCGCTCGGTATGCTCTGGTGGCTCAGTCTGACGACGCGCAGCGCTCACTGATACAGTTGAA
AACGACTGATGAGTGA
 Primer design