SecReT6
Protein ID: 146312552
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2910
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3152243..3154618 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA4WCZ5
KEGG IDent:Ent638_2910
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 73..129
DUF1305 [PF06996], Evalue: 1.20E-07, Aligned region: 115..137
DUF1305 [PF06996], Evalue: 1.20E-07, Aligned region: 402..471
Protein Sequence: 791 a.a.     [Download]
>gi|146312552|ref|YP_001177626.1| ImpA domain-containing protein [Enterobacter sp. 638]
MATAETLLTLCLPDADQRSALLAKSRESLSLWSPWLTPLATGNGAGDDPTYEDDFQVMREEINKLSGTDS
GVLCRLAESILTQHARDIRVVTWYAWARLQRDGDAGLTDGVLLLAAMLDQAGQHCHPQRSTARLAALDWL
NSDKVLDAFSRWPDVTREPDYRAQLKRLYLQQSWTELIEQVDVMFTEGGNRFWLDLQWYLWQGLIRAGNP
WEQWADYIMSDLKLMLKRLPGLETLAWNDGTPLADEVTLGWIVEKVNNDMPVFTEEPTGLKGAQTDDIFA
LEAEAMEKGDSAGPEAALGWLQSRPGMATPRSRWLLRLLMARVAEQYGRNELALHLLGELTASAPKLTLS
DWEPGLLFDVQARRLRLLRMKAGRSESDKVRFAPEMDSLLAGLIALDPARAMVLCGYPVTFEAGGMDDTS
QCLLGLVGLGIPGTAEQVATPVSRFLALLGTMRIPTRNAEGTRDAIIAYINAHEAAFARYLREMPLNNRK
LPLWQQADMVWGNRVLPNIRPMKERYMQAYILRTHNDIQAFNIGHAMSNIGKGITECWDGWMTQEEIETI
SELQSIASKLDQQLSTTISGGWEEGRLTYRAESIINANPLPAEIPRYELDRSVRIEADEKPSQTGIYLPD
IDFAPACFISASYHLPPEARRGIERSDYVGLDGKPSYGWKKSEWAKTGWTLIRRIEGEFIDVPPEGFFPE
GKPAELYNWSQREKKLLQEERERITCWSGAFAPFNGRWATIVNGTTQYIQTHTGQAMPEFEDKQGKKHRA
CWSLLKRDDDGNVFIIPDLMR
 
Nucleotide Sequence: 2376 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3154618-3152243 Enterobacter sp. 638, complete genome
ATGGCGACTGCAGAAACGCTCCTGACCCTGTGTCTTCCGGATGCGGACCAGCGTTCCGCACTGCTCGCTA
AGAGCCGGGAAAGTCTCTCTCTGTGGTCACCGTGGCTGACGCCGCTGGCAACCGGCAACGGTGCCGGGGA
TGACCCGACCTATGAGGATGATTTCCAGGTGATGCGCGAGGAAATCAACAAGCTTTCCGGTACCGATTCC
GGGGTGCTTTGTCGCCTGGCGGAAAGCATTCTCACCCAACATGCCCGCGATATTCGGGTGGTGACCTGGT
ATGCCTGGGCGCGCCTGCAGCGTGACGGTGATGCGGGTCTGACCGACGGTGTCCTGCTGCTGGCGGCCAT
GCTGGATCAGGCGGGGCAACACTGCCATCCGCAGCGCAGCACCGCCAGGCTGGCTGCACTCGACTGGCTG
AACAGTGATAAAGTGCTGGATGCATTCTCGCGCTGGCCTGACGTGACGCGGGAACCAGACTATCGTGCTC
AACTGAAACGCCTATATCTGCAACAGAGCTGGACAGAACTCATTGAGCAGGTGGATGTGATGTTCACCGA
AGGCGGTAACCGCTTCTGGCTCGATTTGCAGTGGTATCTGTGGCAGGGACTGATCCGCGCAGGAAATCCT
TGGGAGCAATGGGCCGACTATATTATGAGCGACCTGAAGCTGATGCTCAAACGCCTGCCGGGTCTGGAAA
CCCTTGCCTGGAATGACGGTACGCCGCTTGCCGATGAGGTGACGCTCGGCTGGATAGTGGAGAAGGTCAA
CAATGACATGCCCGTGTTTACCGAAGAGCCTACCGGCTTAAAGGGAGCCCAGACCGATGACATTTTTGCG
CTGGAAGCGGAAGCGATGGAAAAGGGTGACAGCGCTGGTCCGGAGGCGGCGCTAGGCTGGCTTCAGAGTC
GTCCGGGTATGGCCACTCCCCGAAGCCGCTGGTTACTCCGCCTACTCATGGCGCGGGTGGCAGAGCAATA
CGGCCGCAACGAGCTGGCCCTGCACCTGCTCGGTGAACTCACCGCCAGTGCGCCAAAACTGACCCTCAGT
GACTGGGAGCCCGGACTGCTGTTCGACGTGCAGGCCCGCCGTCTGCGCCTGCTGCGCATGAAAGCCGGGC
GCAGTGAAAGCGACAAGGTCCGTTTTGCCCCGGAAATGGACAGCCTGCTGGCCGGGCTGATTGCCCTCGA
TCCGGCGCGTGCGATGGTGCTGTGCGGATACCCGGTGACCTTCGAGGCAGGTGGGATGGATGACACCTCG
CAGTGCTTGCTGGGGCTGGTTGGTCTTGGCATCCCGGGTACGGCAGAGCAGGTGGCTACACCGGTTTCCC
GTTTTCTGGCGTTGCTCGGCACCATGCGAATACCTACCCGCAATGCCGAAGGTACCCGCGATGCGATTAT
TGCCTACATTAACGCTCATGAAGCCGCTTTTGCCCGTTATCTGCGGGAAATGCCGTTAAATAACCGTAAA
CTTCCGCTCTGGCAACAGGCTGATATGGTGTGGGGAAACCGGGTACTACCCAACATTCGTCCAATGAAAG
AACGGTATATGCAGGCGTATATTCTACGCACCCATAATGATATCCAGGCATTTAACATCGGTCATGCGAT
GAGCAATATTGGCAAAGGCATTACCGAATGCTGGGATGGCTGGATGACGCAGGAGGAAATCGAAACAATA
TCTGAACTTCAGAGCATTGCGTCCAAATTAGATCAACAACTATCAACCACAATTTCTGGAGGTTGGGAAG
AAGGGCGTCTGACTTATCGCGCTGAAAGTATTATCAACGCCAACCCATTGCCTGCTGAGATTCCCCGCTA
TGAGCTTGATCGTTCAGTTCGTATAGAAGCCGATGAAAAACCCTCTCAAACCGGTATCTATTTACCAGAT
ATAGATTTTGCTCCAGCTTGCTTTATATCTGCCAGCTATCATCTCCCTCCAGAGGCAAGGAGGGGGATTG
AACGAAGTGATTATGTTGGACTCGATGGGAAACCTAGTTATGGCTGGAAAAAGTCTGAGTGGGCCAAAAC
AGGCTGGACGCTGATCCGTCGTATTGAAGGTGAGTTTATTGATGTCCCGCCAGAGGGTTTTTTCCCGGAA
GGGAAACCGGCAGAGCTTTATAACTGGTCACAGCGTGAAAAGAAACTTTTGCAGGAGGAAAGGGAACGTA
TTACTTGCTGGAGCGGCGCTTTTGCACCGTTCAATGGTCGCTGGGCAACCATTGTTAACGGCACAACGCA
ATATATTCAAACCCACACCGGACAGGCCATGCCGGAATTTGAAGATAAGCAGGGCAAAAAACATCGGGCC
TGTTGGTCGCTGCTGAAGCGTGATGATGATGGCAATGTTTTTATTATTCCTGATTTAATGCGCTGA
 Primer design