SecReT6
Protein ID: 146312553
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2911
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3154619..3157903 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA4WCZ6
KEGG IDent:Ent638_2911
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.40E-77, Aligned region: 385..698
DUF1215 [PF06744], Evalue: 1.70E-35, Aligned region: 819..940
ImcF-related_N [PF14331], Evalue: 0.0011, Aligned region: 141..197
ImcF-related_N [PF14331], Evalue: 0.0011, Aligned region: 255..314
Protein Sequence: 1094 a.a.     [Download]
>gi|146312553|ref|YP_001177627.1| ImcF domain-containing protein [Enterobacter sp. 638]
MWVKDTFNLGPISATGIVIICLLLMLAAVIIGWVLETVFTKNGEKQGNLDVVASGQQAAASQPEAKHTDA
DTSRFVAEALVDHLRLRYRRRWKAKVRLLLVQGTDNDIEKVVPGLKRDHWQESDGIVLIHGGLPESVPDD
EFLSVLKDVRPQRPLDGVVQVMNAGELPDTAKQDTLVRARQKTDTLLGWQLPVWLWLVREGIWSHDGEGV
PPTGALFGPGATTEETRETLTTLSSELQTPGVAALLENSQHHWLLSLSKALRGSLRRSLVPLLTTLMSGP
APYRLRGVMFSPALSGTETVPHVRLSPAVWQELENNSLQVQARKIGFHWQKVLRLVLLGLVLLWGAGTLL
SLSVNRTQIWLAQDTARVAADTKQPLPERLRNQLALQQTIARLQNREVHGAPWYTRFGLNQDSDMLKMLW
PLYDRNNQQLMRDALADELHRQLNAFVQLPPASDARTSATQKTYSLLKGYLMLARPDKADANWLAGNMLK
AWPHRSGVPDSVWQTQAPKLLGFYAQNLPAHPEWKITPDRDLVGTVRQILLKQIGQRNAESGLYQEMLGR
IARNWPDLSLADMTGDTDASSLFSSEEVVPGMFTRQAWEEQVEDAIDEVVKTRRDEIDWVLTDKTHQPGN
DVSPEALKQRLTERYFTDFGNAWLNMANSIQWQEASSLSEAIAQLNLLADVRQSPLVALMNTLAWQGQTG
AKGEALADSLVDSARKLVGRQKSPKQFIEQAQGPKGPLDGVFGPLTGLMAGKDGTGSNGNLSFQSWLARV
TQVRLKLQQVTSAPDPQAMSQMLAQTVFQGKAIDLTDTRDYGSLVAASLGQEWNGFGQALFVQPLDLAWR
QVLAPAAGSLNARWQSTVVSQWNTAFAGRYPFKTTGSDASLPLLAQFLRSDSGRIAAFIKTNLSGVLHQE
GSHWVVDPAASQGMSISPAFLTAINQLADISDIVFAQGDAGVHFELMARPSRDVARTQLTLDGQKLDYFN
QMESWQSFTWPGNTYYPGVDLSWRSVNTEMRLYESHQGNWGFIRLLDKALITPLDSSRTQLVWITPDGNP
LKFILRSELGDGPLALLKLQGFSLPQTIFSVGATDGSLTLAGDE
 
Nucleotide Sequence: 3285 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3157903-3154619 Enterobacter sp. 638, complete genome
GTGTGGGTCAAGGACACCTTCAATCTGGGCCCGATCAGCGCGACAGGCATTGTGATCATTTGTCTTTTGC
TGATGCTGGCGGCAGTAATCATCGGTTGGGTACTTGAAACTGTATTCACGAAAAACGGTGAGAAGCAGGG
AAATCTGGATGTGGTTGCCTCCGGACAGCAGGCGGCTGCATCCCAGCCTGAAGCAAAGCATACCGATGCG
GATACCTCCCGGTTTGTGGCGGAAGCGCTGGTCGATCATCTGCGCCTGCGTTACCGTCGCCGCTGGAAAG
CCAAAGTTCGCCTGCTGCTGGTACAGGGTACTGATAACGATATCGAAAAAGTGGTGCCAGGACTGAAACG
CGATCACTGGCAGGAAAGTGACGGGATTGTGCTGATCCACGGTGGTCTGCCTGAAAGCGTGCCCGATGAT
GAGTTCCTGTCCGTCCTGAAAGATGTGCGCCCACAGCGACCGCTGGACGGTGTGGTGCAGGTGATGAATG
CGGGTGAACTGCCGGATACGGCGAAGCAGGACACCCTGGTGCGTGCACGCCAGAAAACCGATACGTTGCT
GGGCTGGCAGTTGCCGGTCTGGCTGTGGCTTGTCCGGGAGGGCATCTGGTCCCATGACGGGGAAGGAGTG
CCCCCAACCGGAGCGTTGTTTGGTCCAGGGGCGACGACGGAAGAGACCCGCGAGACACTCACCACCCTGT
CGTCAGAATTGCAGACGCCCGGTGTGGCGGCGCTGCTCGAGAATTCACAGCACCACTGGCTGCTGAGCCT
GTCAAAAGCTCTGCGCGGCTCGTTGCGACGCTCTCTGGTGCCGTTGCTGACCACGCTGATGTCGGGCCCG
GCCCCGTATCGTCTGCGTGGGGTGATGTTCAGCCCGGCATTGTCTGGAACCGAAACGGTACCGCATGTTC
GCCTGTCACCGGCAGTCTGGCAGGAACTCGAAAACAACAGCCTGCAGGTGCAGGCCCGTAAAATTGGCTT
CCACTGGCAAAAGGTGCTGCGCCTGGTACTGTTGGGGCTGGTTCTGCTCTGGGGGGCGGGTACGCTGCTG
TCGCTTTCCGTTAACCGCACCCAAATCTGGCTGGCCCAGGATACGGCCCGTGTTGCTGCTGACACAAAGC
AGCCTTTGCCCGAACGCCTGCGTAACCAACTGGCGCTGCAACAGACTATTGCCCGCCTGCAGAACCGCGA
GGTACACGGTGCGCCGTGGTACACCCGCTTTGGCCTGAACCAGGACAGCGACATGCTGAAGATGCTCTGG
CCACTGTATGACCGTAATAACCAGCAGCTGATGCGCGACGCGCTGGCAGACGAGCTTCACCGCCAGCTCA
ACGCTTTTGTGCAGTTGCCTCCGGCAAGCGATGCGCGTACCTCTGCCACCCAGAAGACCTACAGCCTGCT
CAAGGGTTACCTGATGCTGGCCCGTCCCGACAAAGCGGATGCGAACTGGCTTGCCGGTAACATGCTGAAA
GCCTGGCCGCACCGCAGCGGTGTGCCGGACAGCGTGTGGCAGACCCAGGCACCGAAGCTGCTCGGCTTCT
ATGCGCAGAACTTACCGGCACACCCTGAGTGGAAAATAACCCCCGACCGCGACCTGGTGGGGACGGTACG
CCAGATTTTGCTCAAGCAGATTGGTCAGCGTAACGCGGAATCGGGTCTGTACCAGGAGATGCTCGGGCGC
ATTGCCCGCAACTGGCCGGATTTAAGTCTCGCTGACATGACCGGTGATACCGATGCCTCTTCCCTTTTCT
CCTCCGAAGAAGTGGTGCCGGGGATGTTCACCCGCCAGGCGTGGGAAGAGCAGGTTGAGGATGCGATTGA
TGAGGTAGTGAAAACCCGCCGCGATGAAATCGACTGGGTGCTGACCGACAAGACCCATCAACCAGGCAAT
GACGTCTCGCCGGAAGCGTTGAAGCAGCGCCTGACAGAGCGTTACTTCACTGATTTTGGCAACGCCTGGC
TCAACATGGCCAACAGCATTCAGTGGCAAGAAGCGTCATCACTTTCGGAGGCCATTGCCCAGCTGAACCT
GCTGGCGGATGTGCGTCAGTCACCTCTGGTGGCGCTGATGAATACCCTTGCCTGGCAGGGGCAGACCGGG
GCTAAAGGAGAAGCTCTTGCGGATTCCCTGGTGGATTCGGCGAGAAAACTGGTGGGTCGTCAGAAGAGTC
CAAAACAGTTTATCGAACAAGCGCAGGGCCCCAAAGGTCCGCTGGACGGCGTATTTGGTCCGCTCACGGG
CCTGATGGCCGGGAAGGACGGGACCGGCTCGAACGGTAACCTCAGCTTCCAGTCCTGGCTGGCCCGTGTG
ACCCAGGTGCGCCTCAAGCTCCAGCAGGTGACGAGCGCGCCCGATCCGCAGGCTATGTCCCAGATGCTGG
CACAGACTGTTTTTCAGGGTAAAGCAATCGATCTGACTGACACCCGTGATTATGGCTCTCTGGTGGCAGC
AAGTCTCGGTCAGGAGTGGAATGGATTTGGTCAGGCGCTGTTTGTGCAGCCGCTCGACTTGGCCTGGCGT
CAGGTACTGGCACCGGCCGCAGGCAGCCTCAACGCCCGCTGGCAGAGCACCGTTGTATCGCAGTGGAACA
CCGCCTTTGCCGGACGCTATCCGTTTAAAACTACCGGCAGCGACGCCTCACTGCCACTTTTGGCCCAGTT
CCTGCGAAGCGACTCCGGGCGTATCGCGGCATTTATCAAAACTAACCTCAGCGGCGTGCTGCATCAGGAA
GGCAGTCACTGGGTGGTCGATCCTGCGGCCAGCCAGGGGATGAGCATCAGTCCTGCGTTTCTCACCGCCA
TCAATCAGTTGGCCGACATTTCGGATATTGTTTTTGCCCAGGGCGATGCTGGGGTGCATTTTGAACTGAT
GGCCCGGCCGTCGCGCGATGTGGCCCGTACCCAGTTGACACTGGATGGCCAGAAGCTGGATTACTTCAAC
CAGATGGAAAGCTGGCAGAGTTTTACCTGGCCGGGCAACACTTATTACCCGGGTGTGGATCTGAGCTGGC
GTTCAGTGAACACCGAAATGCGCCTGTATGAAAGCCACCAGGGGAACTGGGGCTTCATCCGCCTGCTGGA
TAAGGCGCTGATCACTCCGCTCGACAGCAGCCGCACCCAGCTGGTGTGGATCACCCCGGACGGTAATCCG
CTGAAATTCATACTGCGCAGCGAACTCGGTGACGGGCCACTGGCACTGCTCAAACTTCAGGGCTTCAGCC
TGCCGCAGACTATTTTTTCCGTGGGCGCGACTGACGGCTCACTCACCCTTGCCGGAGACGAATAA
 Primer design