SecReT6
Protein ID: 146312555
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2914
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3158766..3160115 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4WCZ8
KEGG IDent:Ent638_2914
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-119, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|146312555|ref|YP_001177629.1| hypothetical protein Ent638_2914 [Enterobacter sp. 638]
MKIHRPLWNEGALLAPQQFQQQSEWDAFSRAGIAARGNAFPWGVGRVELDDAMLASGRIQAQSLRLWLPD
DTLVDTLLSDQPPEPREIEAPASANNAPVTVYVALPVMQAGIVNVQTDTIPAERPLRYREAWETIADRFG
QEEESMAVARYNLAFRFGHEDNCAWDICAVARLLRDGQGGWRHDPDFIPPMALFSASRGLCERLALLNRQ
LRSRRQRLMSMRRESNDRMADFAVADVSLFWLLNALNSHARVLSEYDRFPDRHPEQVWAELTRLAGSMLT
FSLEHDLDAIPGYDHSAPEQTFPPLFDLISELLEASLPSRVVAVRMDRMDPETWKAVLHDIRLRDEADFY
LSVRANQPAWQIAERFAEVCIAGAPANVGEVSGLAVEGIGLIVLSRVPAALPVRLENQFFVLDMESNAAR
EMLDQGVCVFYVPSVLGELELELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3160115-3158766 Enterobacter sp. 638, complete genome
ATGAAAATTCATCGTCCGTTATGGAATGAAGGGGCGCTTCTGGCTCCTCAACAGTTTCAGCAGCAGTCTG
AATGGGATGCATTTTCCCGGGCCGGTATTGCCGCCCGCGGAAATGCTTTCCCCTGGGGCGTTGGTCGGGT
TGAGCTTGATGACGCGATGCTGGCTTCCGGCCGGATCCAAGCGCAGTCATTGCGTCTCTGGCTTCCGGAT
GACACATTGGTCGATACCCTGCTCAGTGACCAGCCACCGGAGCCGCGTGAAATTGAGGCACCTGCTTCTG
CCAACAATGCCCCGGTGACGGTGTATGTGGCGTTACCGGTGATGCAGGCCGGGATCGTGAATGTGCAGAC
GGACACGATCCCCGCAGAGCGCCCGCTTCGCTATCGAGAAGCCTGGGAGACGATCGCCGATCGTTTCGGT
CAGGAAGAAGAGTCGATGGCGGTGGCCCGCTATAATCTCGCATTCCGTTTCGGACATGAAGACAACTGCG
CCTGGGATATCTGCGCCGTTGCCCGTTTGTTGCGGGACGGGCAGGGAGGCTGGCGTCATGATCCTGACTT
TATCCCGCCGATGGCCCTGTTCTCGGCAAGCCGTGGCCTGTGTGAACGCCTTGCACTGCTGAATCGTCAG
CTGCGCTCTCGTCGCCAGCGTCTGATGTCCATGCGTCGTGAAAGCAACGACAGAATGGCCGATTTTGCGG
TCGCTGATGTGTCGTTGTTCTGGCTGCTAAATGCGCTGAACTCGCATGCCCGGGTACTCTCGGAGTATGA
TCGTTTCCCTGACAGGCATCCTGAGCAGGTCTGGGCCGAGCTGACACGGCTTGCCGGCAGTATGCTGACC
TTCTCGCTTGAGCACGATCTGGATGCGATCCCGGGTTACGACCACAGCGCGCCGGAGCAAACCTTCCCGC
CACTCTTTGACCTTATCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGCGTGGTGGCCGTCCGGATGGA
TCGCATGGATCCGGAAACCTGGAAAGCGGTACTGCACGATATTCGTCTGCGCGATGAAGCCGATTTCTAT
CTCTCCGTCCGGGCGAATCAGCCGGCCTGGCAGATAGCTGAACGCTTTGCCGAAGTCTGTATTGCCGGTG
CGCCGGCTAATGTTGGCGAAGTGTCCGGTCTCGCTGTCGAGGGTATCGGTCTCATTGTCCTGAGCCGCGT
GCCTGCTGCGCTGCCAGTGCGCCTGGAGAACCAGTTCTTTGTGCTTGATATGGAGAGTAATGCCGCCCGT
GAAATGCTGGATCAGGGTGTCTGCGTCTTCTATGTTCCGTCCGTGCTCGGCGAGCTTGAGCTGGAACTGT
TTGCGGTGCTGCGCTCATGA
 Primer design