SecReT6
Protein ID: 146312556
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2915
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3160133..3161740 [-]
Producthypothetical protein
NoteTssC
UniProt IDA4WCZ9
KEGG IDent:Ent638_2915
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-173, Aligned region: 109..531
Protein Sequence: 535 a.a.     [Download]
>gi|146312556|ref|YP_001177630.1| hypothetical protein Ent638_2915 [Enterobacter sp. 638]
MLWHRKKSDGRDVKRFNEEKMLMSVKNEYTTGSETVVLERSESGGVYASLFEKINLNPVSELSALDIWQD
AQAMSDATSDERLTAGMQVFLECLSKAGSKVEKLDKNLIDHHIAELDYQISRQLDAVMHHDDFQAVESLW
RGVKSLVDKTDFRQNVKIELLDLSKASLRQDFEDAPEIIQSGLYKHTYIDEYDTPGGEPIGALISAYEFD
ASAQDVALLRNISKVSAAAHMPFIGSAGPKFFLKNSMEDVAAIKDIGNYFDRAEYIKWKSFRNTDDSRYI
GLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPEHDKYLWTNASFAFASNMVRSFINNGWCVQIRGPQAGG
AVQDLPIHLYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSFYKNRDYSCFFSANSTQKPALYDTADA
TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRD
AKVVVEDIEDNPGFFRVKLFAVPHFQVEGIDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3161740-3160133 Enterobacter sp. 638, complete genome
GTGCTCTGGCACCGAAAAAAGTCTGACGGTCGCGATGTTAAACGGTTTAATGAAGAGAAAATGCTGATGT
CTGTAAAAAATGAATATACGACTGGTAGTGAAACCGTCGTGCTGGAACGTTCTGAATCAGGTGGTGTATA
TGCATCCCTGTTTGAAAAAATCAATCTCAATCCGGTTTCTGAGCTGAGTGCGCTGGATATATGGCAGGAT
GCACAGGCCATGTCTGATGCAACTTCTGATGAGCGGTTGACCGCCGGTATGCAGGTGTTTCTGGAATGCC
TTAGTAAAGCCGGTTCAAAGGTCGAAAAATTAGATAAAAACCTGATTGACCATCATATTGCGGAGCTTGA
TTACCAAATCAGTCGTCAGCTGGATGCGGTAATGCACCATGACGACTTTCAGGCTGTCGAATCTCTTTGG
CGCGGTGTGAAATCGCTGGTGGATAAAACTGACTTTCGCCAGAACGTCAAAATTGAGCTGCTCGATCTGT
CGAAAGCGTCTTTGCGACAGGACTTTGAGGACGCGCCGGAAATTATTCAAAGCGGGCTGTATAAACATAC
CTATATTGATGAGTACGACACCCCAGGCGGAGAACCCATCGGTGCGTTGATTTCTGCGTATGAATTTGAT
GCGTCAGCACAGGACGTGGCTCTGCTGCGTAATATCTCCAAAGTATCTGCCGCAGCGCATATGCCGTTTA
TCGGCTCTGCCGGCCCGAAATTCTTCCTGAAGAATTCGATGGAGGATGTGGCCGCCATCAAGGATATCGG
TAACTACTTTGACCGCGCTGAATACATCAAATGGAAATCCTTCCGCAATACTGATGATTCCCGTTATATC
GGTTTGGTGATGCCACGTGTACTGGGTCGTCTGCCGTATGGCCCTGACACCGTGCCTGTTCGCAGCTTTA
ACTATGTCGAAGAAGTGAAAGGCCCGGAGCATGATAAATATCTCTGGACCAATGCATCATTCGCCTTTGC
ATCCAATATGGTTCGTAGCTTCATTAACAATGGTTGGTGCGTGCAAATTCGTGGCCCGCAGGCTGGTGGT
GCCGTACAGGATCTGCCTATACATCTGTACGATCTGGGTACCGGCAATCAGGTGAAGATCCCGTCAGAAG
TGATGATCCCGGAAACCCGTGAGTTTGAGTTTGCGAACCTGGGCTTTATTCCACTAAGTTTTTATAAAAA
TAGAGATTATTCCTGCTTCTTCAGCGCTAACTCTACTCAGAAGCCGGCCCTGTATGACACCGCGGATGCA
ACGGCCAACAGCCGCATTAATGCACGTCTGCCCTATATCTTCCTGCTGTCGCGTATTGCGCACTATCTGA
AACTGATTCAGCGCGAAAATATTGGTACGACCAAAGACCGACGTCTTCTTGAACTGGAGCTCAATACTTG
GGTTCGTGGCCTGGTCACCGAAATGACCGATCCGGGCGATGAGTTGCAAGCCTCGCACCCCCTGCGTGAT
GCGAAAGTGGTGGTGGAAGATATCGAGGACAATCCTGGTTTCTTCCGCGTGAAACTGTTTGCCGTGCCGC
ACTTCCAGGTGGAAGGCATAGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCCAAATCCTAG
 Primer design