SecReT6
Protein ID: 146312557
SecReT6 ID205
T6SS typei2
Gene symbol-
Locus tagEnt638_2916
StrainEnterobacter sp. 638
Repliconchromosome [GenBank: NC_009436] [Browse all T6SS(s) in this replicon]
Location [Strand]3161715..3162212 [-]
Producthypothetical protein
NoteTssB
UniProt IDA4WD00
KEGG IDent:Ent638_2916
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|146312557|ref|YP_001177631.1| hypothetical protein Ent638_2916 [Enterobacter sp. 638]
MSNSYQSEIPKARVNIQLSLHTGGAQKKVELPLKLVLVGDYSNGTEQRPVSEREKVNVNKNNFDSVLAEF
SPAIKLSVENTLAHDGSEEAINLTFRDMKDFTPEQVARQIPQLKAMLAMRNLLRDLKANLLDNQAFRKEL
EKILVDPQLSSELRSELSALAPKKV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|146309667|ref|NC_009436.1|:c3162212-3161715 Enterobacter sp. 638, complete genome
ATGTCTAATTCCTATCAATCCGAGATCCCTAAGGCTCGCGTCAATATCCAGTTAAGTTTGCATACAGGTG
GCGCACAGAAAAAAGTCGAATTACCCCTAAAACTTGTTTTGGTGGGTGATTACAGCAACGGAACAGAGCA
GCGTCCCGTGTCGGAGCGCGAAAAGGTCAATGTAAATAAAAATAACTTTGACAGCGTGCTTGCTGAGTTT
TCGCCAGCCATAAAGCTTTCAGTTGAAAACACGCTTGCACATGACGGCAGTGAAGAAGCCATAAATCTCA
CCTTCCGCGACATGAAAGACTTCACACCGGAACAGGTCGCTCGTCAGATCCCTCAACTGAAAGCCATGCT
TGCCATGCGTAATCTTCTCCGAGACCTCAAAGCCAATCTGCTCGATAACCAGGCTTTCCGTAAAGAGCTG
GAAAAAATTCTGGTAGACCCACAACTCAGCAGTGAGCTGCGCAGTGAGTTGAGTGCTCTGGCACCGAAAA
AAGTCTGA
 Primer design