SecReT6
Protein ID: 147671876
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0016
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]16690..19716 [-]
Producthypothetical protein
NoteTssM
UniProt IDA5F1C6
KEGG IDvco:VC0395_0016
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.60E-93, Aligned region: 336..652
ImcF-related_N [PF14331], Evalue: 4.20E-81, Aligned region: 28..285
DUF1215 [PF06744], Evalue: 3.90E-38, Aligned region: 187..196
DUF1215 [PF06744], Evalue: 3.90E-38, Aligned region: 746..866
Protein Sequence: 1008 a.a.     [Download]
>gi|147671876|ref|YP_001214857.1| hypothetical protein VC0395_0016 [Vibrio cholerae O395]
MIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHFVDWLDRTRSRRPLNGIVLALDVAHLATATASER
KAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGFEPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLE
EFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFTRQISGLKEILQQFFQEALASDQFSTSALVRGAY
FTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNSTVYFTQKLFTHIIYPEAGLASDNFRVAKNKRRL
MGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKVNQYKEQFPTSRSLASQREVLDPLNKIREATLEF
GFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRFLPLLMADTIVALNQAETDEEKLAVLRVYRMLVD
KSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDYAMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQ
VELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPVFDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQ
SESVSELALIDSWVLGQSKTAQFSEADKQALREKIRDLYVADYTNTWRAALNEIDVKYFNDINDAVMVLE
NITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELLKSPKYKVASMIETPFADLNGMLKPVGSKPAYMT
EVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLVNADPIYTLKRISSGLPKPLDSMMAKLADESWYV
VKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNKDVALADFEAFFAPNGTLDNFYNQQLKMFIDENI
SVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGILDVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGP
RENVELIWPNTLRDSAVSKVTLIPTQTNMSPRSLQIQGPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEM
IYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3027 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c19716-16690 Vibrio cholerae O395 chromosome 1, complete sequence
TTGATTGGTGATGAATCTGTCCTGATTGATCCTGATGGTGAGCTGTTAACGCAAGGCAATCGTAGTGAAG
AAAATGATGGTGCGTTAGAGCGCCGCTTATGGTTGCATTTTGTCGATTGGCTAGACCGCACTCGTAGCCG
CCGCCCGTTAAACGGCATCGTGTTGGCGTTGGATGTGGCGCATCTTGCTACCGCCACCGCCTCAGAGCGT
AAAGCTTATGCCAATTTGCTGCGTGCTCGTCTGCGTGAGTTGATGGAAACCTTATCGACTCGTCTGCCGG
TGTACATTGCACTGACTAAGCTCGACTTACTGCACGGTTTTGAGCCTTTCTTTAAGCACTACACCAAAAG
TCAGCGCGAAGAGGTGTTGGGTTTTACCTTCTCAATGGATTCGGTAGATAACCTAGATTCATGGTTGGAA
GAGTTTGCCAGTGAGTACACTCAATTTGTGTCACGAGTTAATGGCATGCTGCCGCATGCGGTCGCAGCGC
CAATGACGCTTGAAGAACGTAACGCGATTTACAGCTTCACGCGTCAAATCTCAGGTTTGAAAGAGATTTT
GCAACAGTTTTTCCAAGAGGCTTTGGCGAGCGATCAATTCTCAACGTCAGCGCTGGTGCGTGGTGCCTAT
TTCACGTCGGTTTACCAACAAGGTGTACCTACCAACGCTTTTGATGATGCGGCTTCCCGTCGTTATGGTC
TGTCTCATGCGATTAATACGGCGCAGCGCGCGAAAAACTCCACGGTCTATTTCACGCAAAAACTGTTTAC
CCACATCATTTATCCTGAAGCGGGTTTAGCGTCGGATAATTTCCGGGTTGCAAAAAACAAACGCCGTTTG
ATGGGGCTCTCTTTTGTCGCATGCTCAGTGGCGACTTTGCTGTTGGCGGGAACTTGGCATCGTAACTACC
TCAATAACGTGCAACACGCCGATACTGTATTAACCAAAGTGAATCAGTATAAAGAGCAGTTCCCGACCAG
CCGTTCATTGGCCTCACAAAGAGAGGTATTGGATCCGTTGAACAAGATCCGTGAGGCGACACTGGAGTTT
GGTTTCTTCCGTGATAAACCTCAGTACATCTCCGATTTTGGTCTCTACCAAGGGCACACCATTGGCCCGA
AAGTAGAAGAGACCTACTTAAACTTACTCGAAACTCGCTTCTTGCCTCTGTTGATGGCGGACACCATTGT
TGCGCTCAATCAAGCTGAGACAGATGAAGAAAAATTAGCGGTGCTGCGTGTGTATCGCATGCTGGTCGAT
AAAAGTGGTCGTTACCAAGACTATGTGATGGATTATTTTGCGAAGTATTGGCAAAAATCCTTCTCAGGTC
AGCGTCAAATTCAGGAAGAGCTGCTCGGCCACTTAGATTACGCGATGCGTCATACGGACCTCACTGCAGA
GAGGCTCAATGGTGATAAAGGGGCGGAGCAGGTGATGCGCCCTTACGATAAAGTGATTGCTCGTGCTCAG
GTTGAACTGGGTTCAATGCCAAACGACCAGCGCGTCTATCGTAACTTGAAATTGAGCGCACAAACGGTGC
TTGGTCCTTCGGTTAACTTGCGTAGCTTGATTGGGCCGGTGTTCGATGTGGTGTTTGAAGAGCGCGTTCT
TAACAGTAGCAGCCTGTTTATTCCTCAAATGCTCACCAAGCGTGGTTTTGATGACTACTTTATGCCGCAA
TCTGAATCGGTCTCTGAGCTGGCACTGATTGACAGTTGGGTTCTGGGACAGAGCAAAACGGCACAGTTTA
GTGAAGCAGACAAGCAGGCACTGCGCGAAAAAATCCGCGATCTTTATGTGGCGGATTACACCAACACATG
GCGCGCGGCACTCAATGAAATTGATGTGAAGTATTTCAATGACATCAATGATGCGGTCATGGTTTTGGAA
AATATCACCAGTAACCTTGAGCCGATGCAGCGTCTACTGCGCACATTAGATGACAACACCCAACTGTACA
GTGCGTTACCTAAAGATGAATCGGCGTTAAAAGAGCTGCTGAAAAGTCCGAAATACAAAGTGGCTTCGAT
GATTGAAACTCCGTTTGCTGATCTGAACGGTATGCTCAAACCGGTGGGCAGCAAACCAGCGTACATGACG
GAAGTCTTGGCTTCGGTGGATGAGCTGAAAAGCTACTTGAAATCGATTCAAGATGCTCCCGATGTCGGTA
TGGCGGCGCTCGATGCGACCAAAGCGCGGGTCAAACTGGTTAATGCTGACCCTATCTATACCTTAAAACG
TATCTCGTCAGGACTGCCGAAGCCGCTGGATAGCATGATGGCAAAGCTTGCAGATGAGAGCTGGTATGTG
GTCAAGCAAGAAGCGATCAAGCATCTGGAAGTTCGCTGGACGGAGGATGTGTATAAAACCTTCCAAAGCA
AGCTGGCTGGGCGTTATCCATTCAACCCCGCATCAAATAAAGATGTTGCCTTGGCCGATTTTGAAGCCTT
CTTTGCGCCGAATGGCACGTTAGACAACTTCTACAATCAGCAACTGAAGATGTTTATTGATGAGAACATC
AGCGTCGCGTCGGATGACTCAGCGCAGTCGATCATTCGTAAAGAAGTGCTGGATCAGATCAAGCAAGCGC
AGAAAATTCGTGAGGCTTTCTTCAACCGTAAAGGGATTTTGGATGTCAGCTTCTCGGTTGAGCCGCTCAG
TTTGAGTAACAACAAGCGTCGTAGTGTGCTGAATGTGGATGGTCAGTTCTTAGCTTACAGCCATGGTCCG
CGTGAAAATGTGGAGCTGATTTGGCCTAACACGCTGCGTGATTCTGCGGTGTCTAAGGTGACCTTGATTC
CAACCCAAACCAATATGTCACCGCGCAGTTTGCAAATCCAAGGACCGTGGGCATTCTTCCGCTTATTGGA
TCAAGGTGATGTGGTTTCGGCGAGTCAAACGTCGGTTGATTTCAAATTTATCGTCGATGGCGGTGAGATG
ATCTACCGTATTAACGCAGAGGCCGATGCCAACCCATTTACCGAACGCCTGTTCAAGTCGTTCAAACTGT
CTAAAACACTCTATTAA
 Primer design