SecReT6
Protein ID: 147672059
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0017
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]19706..20227 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDA5F1C7
KEGG IDvco:VC0395_0017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 173 a.a.     [Download]
>gi|147672059|ref|YP_001214858.1| IcmF-related protein [Vibrio cholerae O395]
MWKFIVGIVRRLKPTVVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAV
WGIWQWRKLQAFKSEQKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDW
 
Nucleotide Sequence: 522 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c20227-19706 Vibrio cholerae O395 chromosome 1, complete sequence
ATGTGGAAATTCATTGTTGGAATAGTAAGGCGGCTTAAACCCACGGTGGTGGCAGCACTTCCCATTTTGC
TATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAGGCCCTTGGTTAGAAGTGGCTGGCTA
TAAACCGCTGGAGTCGATCATGGCTCGAGTTGTGGCAAGCAGTCTGTTTACTCTCGGCTGTTTAGCCGTG
TGGGGCATTTGGCAGTGGCGTAAGTTGCAAGCCTTCAAATCGGAGCAAAAGCGCGAAGAGCAACTGCGCC
AAGATCCGATCAAGGTGTATGAGCAGCGCCAAGAGGTTGAACTGAATCAGGTGATGCTCAATATGAAGCA
GAGCCTAAATAAACACAACTACTTGTATGCACTACCTTGGTATTTGGTTCTAGGTTTAGAAAATGCGGGT
AAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCTTCGGTCATGCGAGCTTCGGGACAAA
AAAGCGAAAACCCATACTCGTTTGATTGGTGA
 Primer design