SecReT6
Protein ID: 148261079
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2088
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2298110..2301637 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA5G0A5
KEGG IDacr:Acry_2088
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.70E-88, Aligned region: 181..440
IcmF-related [PF06761], Evalue: 6.70E-81, Aligned region: 495..794
IcmF-related [PF06761], Evalue: 6.70E-81, Aligned region: 858..886
DUF1215 [PF06744], Evalue: 1.00E-25, Aligned region: 911..1034
AAA_19 [PF13245], Evalue: 0.0034, Aligned region: 114..134
AAA_25 [PF13481], Evalue: 0.0088, Aligned region: 108..137
Protein Sequence: 1175 a.a.     [Download]
>gi|148261079|ref|YP_001235206.1| ImcF domain-containing protein [Acidiphilium cryptum JF-5]
MSARLVRWLLSGVGAAIIAALVWFFGPFLAVLAGILPRAAIAVLVFVIWLAANLWLDRRARKKAAAVEEA
ITETQADPEAGMRAEEVAALADKMKKALGILARARGRRGFLYEQPWYVIIGPPGAGKTTALLNAGLNFPL
AAELGQGAVAGVGGTRYCDWWFTDQAVMIDTAGRYTTQDSSASVDQAGWHGFLDLLRRTRPRQPLNGVIV
AIALSDIAQADAAARAAHARAIRARIKEINTRLGVTVPVYALFTKADLIAGFTEFHDDLDTAGRAQVWGM
TFPPDRTPAGMAGRFAAEFRELVGRVEERMLDRLAAERSPDRRSLIAGFPMQVASLQAPLEAFLNEAFAG
SQLDPAPWLRGVYLCSGTQEGTPIDRLTGALARSFGIDQRRAPSLRPQSGRSYFLGRLIGEVIFGEAMLG
SADRSGARRRLALRGAGFGAVGLVFVVLLAALFRSHADNAAAIARARAGLAAEQKVAAQIRLDPVASADL
SRIAPLLREARDLAGAPPERGYHGIGLDQGASIRAATAAVYRNVLDHALLPRLVLQLEAEMRGGLDRPDF
LYQATRVYLMLGNQGPLDASLVEAWMKLDWRRLYPGFGQTALRHSLMRDLTALLARPLPDVPLDGQLIAT
ARATFSRVPIAERVYSRIRDSEAASRVPAWTPAAALGAAGTPYFVNATGKPLTDGVPGFFTKRGFYTVLL
PALTHATQDVARESWVLGAQDRIKPDSPQMQSLEQDVIRLYDTAYARHWQSMIDDLNIAPLGSAGQAVQA
LYVLGSPQSPMVRLLSSMADELTLTKPPKDLAKAAKGATGAEAKLRAPAKLNEAATRLKQLLGPQASGAP
APKPGAAINAEFAPLRNYVGNGAAGSPLSLTLQLIDQVQKQLATLAATAPGAAGPASPAAGGDAAQLLAG
EAQHDPQPVSRWLGAIVATSNSLRGGSAAAAAAAAFKAPGGAAALCEKAVTGHYPFDASAASGIPLADFA
RLFAPGGVMDNFFNTQVRPFVNMTGQVWTVQPVNGVAPPVSQGAVAEFQRAQEIQQMFFLGGTQPSVQFT
VTPAGLSAGAAQVVLQLGGVDVSYAHGPTVPTSVNWPGATGMQTARLIITPAAGGTPVTLQASGPWAVFR
LFGMGRLTRDGSSARYTLTFDQGGMQARFTLEAGSIFNPFAPGVLNDFRCPSLKG
 
Nucleotide Sequence: 3528 bp     [Download]
>ref|NC_009484.1|:c2301637-2298110 ImcF domain-containing protein [Acidiphilium cryptum JF-5]
ATGAGCGCACGGCTGGTCCGCTGGCTGCTGAGCGGCGTCGGCGCCGCGATCATCGCGGCCCTGGTCTGGT
TCTTCGGCCCCTTCCTCGCCGTGCTCGCCGGCATCCTGCCGCGCGCGGCGATCGCTGTCCTGGTGTTCGT
GATCTGGCTTGCGGCCAATCTCTGGCTCGATCGCCGCGCCCGCAAGAAGGCGGCCGCCGTCGAAGAGGCG
ATCACCGAGACCCAGGCCGACCCCGAGGCCGGCATGCGGGCGGAGGAAGTCGCCGCGCTGGCGGACAAGA
TGAAGAAGGCGCTCGGCATCCTCGCCCGGGCGCGCGGCCGGCGCGGCTTTCTCTACGAACAGCCCTGGTA
CGTCATCATCGGCCCGCCCGGCGCCGGCAAGACCACCGCGCTGCTCAATGCCGGGCTGAACTTTCCGCTC
GCCGCCGAGCTCGGCCAAGGGGCGGTCGCCGGTGTCGGCGGCACCCGCTATTGCGACTGGTGGTTCACCG
ACCAGGCGGTGATGATCGACACCGCCGGCCGCTACACGACGCAGGATTCCTCGGCGTCGGTCGACCAGGC
CGGCTGGCACGGCTTCCTCGACCTGCTGCGCCGCACCCGGCCGCGCCAGCCGCTGAACGGCGTGATCGTC
GCCATCGCCCTGTCCGACATCGCCCAGGCCGACGCCGCGGCCCGCGCCGCCCATGCGCGCGCCATCCGCG
CGCGGATCAAGGAGATCAACACCCGCCTCGGCGTCACCGTGCCGGTCTACGCGCTGTTCACCAAGGCCGA
CCTGATCGCCGGCTTCACCGAGTTCCATGACGATCTCGACACCGCCGGCCGCGCGCAGGTCTGGGGCATG
ACCTTTCCGCCCGATCGCACGCCGGCGGGCATGGCGGGCCGGTTCGCCGCCGAGTTCCGCGAGCTGGTCG
GCCGCGTGGAAGAGCGCATGCTCGACCGCCTCGCCGCCGAACGCAGCCCGGATCGCCGCTCGCTCATCGC
CGGCTTCCCGATGCAGGTCGCGAGCCTGCAGGCGCCGCTGGAGGCCTTCCTGAACGAGGCGTTCGCCGGC
TCCCAGCTCGATCCCGCGCCGTGGCTACGCGGGGTCTATCTCTGCTCGGGCACGCAGGAAGGCACGCCGA
TCGACCGTCTGACCGGCGCGCTGGCCCGCAGCTTCGGCATCGACCAGCGGCGCGCGCCCAGCCTGCGGCC
GCAATCCGGCCGCTCCTATTTCCTTGGCCGGCTGATCGGCGAGGTGATCTTCGGCGAGGCCATGCTGGGC
TCGGCGGACCGGTCCGGCGCCCGGCGCCGCCTCGCGCTGCGCGGCGCGGGGTTCGGCGCGGTCGGCCTCG
TGTTCGTCGTGCTGCTCGCGGCGCTGTTCCGCAGCCATGCCGACAATGCCGCCGCCATCGCCCGCGCGCG
CGCCGGGCTTGCCGCCGAACAGAAGGTCGCGGCGCAGATCCGGCTCGATCCGGTCGCCAGCGCCGATCTG
TCGCGGATCGCGCCGCTGCTGCGCGAGGCCCGCGACCTTGCCGGCGCGCCCCCCGAGCGCGGCTATCACG
GTATCGGCCTCGACCAGGGCGCCTCGATCAGGGCTGCGACCGCCGCCGTCTACCGCAACGTGCTCGACCA
TGCGCTGCTGCCGCGCCTCGTGCTTCAGCTCGAGGCGGAAATGCGCGGCGGGCTCGACCGGCCGGATTTC
CTGTATCAGGCGACCCGCGTCTATCTCATGCTCGGCAATCAGGGACCGCTCGACGCCTCGCTGGTCGAGG
CCTGGATGAAGCTCGACTGGCGGCGCCTCTATCCGGGCTTCGGCCAGACCGCGTTGCGCCATTCGCTGAT
GCGGGACCTGACCGCGCTGCTCGCCCGCCCGCTGCCGGACGTTCCGCTGGACGGCCAGCTGATCGCCACC
GCGCGCGCGACCTTCTCGCGCGTGCCGATCGCCGAGCGGGTCTATTCCCGCATCCGCGATTCCGAGGCGG
CGTCCCGCGTGCCGGCCTGGACGCCGGCGGCGGCGCTGGGGGCTGCCGGAACGCCCTATTTCGTCAACGC
CACCGGCAAGCCGCTGACCGATGGCGTGCCCGGCTTCTTCACCAAGCGCGGCTTCTACACCGTGCTGCTG
CCGGCCCTCACCCATGCGACACAGGATGTCGCCAGGGAAAGCTGGGTGCTCGGCGCACAGGACCGGATCA
AGCCGGATTCGCCGCAGATGCAGTCGCTCGAGCAGGATGTGATCCGGCTCTATGACACCGCCTATGCCCG
GCACTGGCAGTCGATGATCGACGACCTCAATATCGCGCCCCTCGGCTCCGCGGGCCAGGCCGTGCAGGCG
CTCTACGTGCTTGGCTCGCCCCAATCGCCGATGGTGCGGCTGCTGTCGTCGATGGCGGACGAGCTTACGC
TCACCAAACCCCCGAAAGACCTTGCGAAGGCCGCCAAGGGGGCGACGGGCGCCGAGGCGAAGCTGCGGGC
ACCGGCCAAGCTGAACGAAGCGGCGACGCGGCTGAAGCAGTTGCTGGGCCCGCAGGCGTCAGGCGCCCCG
GCCCCGAAGCCCGGGGCGGCAATCAACGCCGAGTTCGCGCCGCTGCGCAATTATGTGGGCAACGGCGCGG
CAGGCTCTCCGCTCTCGCTGACATTGCAACTGATCGACCAGGTGCAGAAGCAGCTGGCAACCCTCGCCGC
CACGGCGCCCGGCGCGGCGGGCCCCGCGTCCCCCGCCGCCGGCGGCGATGCGGCCCAGCTCCTTGCCGGC
GAGGCGCAGCACGATCCGCAGCCGGTCAGCCGCTGGCTCGGCGCGATCGTCGCGACATCGAACAGCCTGC
GCGGCGGCAGCGCCGCGGCGGCGGCGGCGGCGGCGTTCAAGGCGCCGGGCGGTGCCGCGGCACTCTGCGA
GAAGGCGGTGACCGGCCATTACCCGTTCGATGCAAGTGCCGCCTCGGGCATTCCGCTTGCCGATTTCGCC
CGTCTCTTCGCGCCGGGCGGCGTGATGGACAATTTCTTCAACACGCAGGTGCGGCCCTTCGTGAACATGA
CCGGGCAGGTATGGACGGTGCAGCCGGTGAACGGCGTGGCGCCGCCGGTCAGCCAGGGGGCCGTCGCGGA
ATTCCAGCGCGCGCAGGAAATCCAGCAGATGTTCTTCCTGGGCGGCACGCAGCCCAGCGTGCAGTTCACG
GTCACGCCCGCCGGCCTCTCGGCGGGCGCGGCACAGGTCGTGCTGCAGCTTGGCGGCGTCGATGTCAGCT
ACGCCCACGGCCCGACGGTGCCGACCTCGGTGAACTGGCCGGGTGCCACCGGCATGCAGACGGCCCGGCT
GATCATCACGCCGGCCGCCGGCGGCACGCCGGTCACGCTTCAGGCCAGCGGTCCCTGGGCGGTGTTTCGC
CTGTTCGGCATGGGGCGGCTCACGCGTGACGGCAGCTCCGCCCGCTACACCCTCACCTTCGATCAGGGGG
GCATGCAGGCGCGCTTCACGCTCGAGGCGGGGTCGATCTTCAACCCGTTCGCGCCGGGCGTGCTGAACGA
CTTCCGCTGCCCGAGCCTCAAAGGATGA
 Primer design