SecReT6
Protein ID: 148547351
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2130
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2410709..2414329 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA5W2A9
KEGG IDppf:Pput_2130
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.90E-84, Aligned region: 110..154
IcmF-related [PF06761], Evalue: 3.90E-84, Aligned region: 524..831
ImcF-related_N [PF14331], Evalue: 1.70E-69, Aligned region: 218..476
DUF1215 [PF06744], Evalue: 9.80E-30, Aligned region: 928..1049
Protein Sequence: 1206 a.a.     [Download]
>gi|148547351|ref|YP_001267453.1| unnamed protein product [Pseudomonas putida F1]
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRSVASLVLVLVP
LLCWLGVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLDNAGGRRALYRLPWYLVLGDE
QAGKSSFIDRTDQRFTLTRIDQAQARGRQAEALAYPVGWWVSDDAVIIDPPGVFISQKPPVGSAANDPTN
ASSPPGIQARLWEHLLGWLQRKRSQRALNGVLLVVDLPALLHGKPEQRVALAHGLRTRLYEVSSQLGARL
PLYVVLTKFDLLDGFDQFYSQLPAAKRESLLGFTFKLDAVDAFDAWLDEYDEHYRRLLTQLHEQVIDRLD
VLGKTAPCVRLFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAFSIAIASWQRY
AEINGAKAASVLAKSQEYSGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPVVADFGLYQGRNIG
PLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAALRVYRMIEDRNSRRPEWVEGWMARQWQRAF
PGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSEVQQVLRKLPLPQRVYAGLKQQSYEQVHAGLDLRHQV
GPAFDVVYQPSSGSRQGGEDVRLAGMLTAKGFRDYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDAL
TERLYNLYSADYIDSWRRALNAFTVADFRDMDHGVAILEQLTGPAAPLQRLLDTVRDNTSLASPAVVESP
GELSTLRVATGKPEQPQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQDSPDRGKAAL
QAVHQRFAMTGQDPIGTLQRVATGLPEPISHQVRKLADQTAQVLNVEALRELERRWDADVYSFFQQRLAG
RYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKDNLEALQSAQHGQSLIRADVIEQLELAERIR
ETFFDQRGQLSVQFSIEPLGLSANQRTSLLDLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNG
NSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQ
QPANGVQAALSDEQRL
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2410709-2414329 Pseudomonas putida F1 chromosome, complete genome
ATGAATCAAATATGGACGCAACTCAAACGTTGGGGCTGGCCGTGGGTAACGCGCATTGGCCTGGCGCTGC
CGCTGCTGCTCGGGCTTGGCGCTTTGCTGATGCTGGTCGCTATCTGGTGGCTTGGCCCGCAATGGACGTG
GCGGGAGCAGCAGCCGCTGGCAAGTGTGGCTCATCGCAGCGTGGCAAGCCTGGTGCTCGTGCTGGTGCCG
CTTCTGTGCTGGCTTGGGGTGCTGCGCACGCGCTTTCGCCGCCTGCAAGCGGAGCGCCGGCAGGCACTGG
CCGCCGAACAGGATGTCGCGCTACCGTTCGTGCAGGCGCAAGAGCGGGCCTTGAGCCAGGGGCTTGAGCG
GTATCTCGACAATGCCGGTGGGCGACGCGCGTTGTACCGGCTGCCTTGGTACCTGGTGTTGGGCGACGAA
CAGGCCGGTAAAAGCAGCTTCATCGACCGCACCGATCAGCGCTTTACCCTGACGCGTATCGACCAGGCCC
AGGCACGGGGCCGACAGGCTGAAGCACTGGCCTATCCGGTAGGCTGGTGGGTCAGCGACGATGCCGTGAT
CATCGACCCGCCCGGCGTTTTCATCAGTCAAAAACCACCGGTGGGCTCGGCGGCCAACGACCCCACCAAT
GCCTCCTCGCCGCCCGGTATCCAGGCCCGGTTATGGGAGCACCTGTTGGGCTGGCTGCAGCGTAAGCGAA
GCCAGCGGGCGCTCAATGGTGTGTTGCTGGTGGTCGACCTGCCGGCGCTGCTGCATGGCAAGCCCGAGCA
GCGCGTCGCGCTGGCCCATGGGTTGCGCACACGCCTGTACGAAGTGAGCAGTCAGTTGGGCGCGCGCCTG
CCGCTGTACGTGGTCCTGACCAAATTCGATCTGCTGGACGGCTTCGACCAGTTCTACAGCCAGCTTCCGG
CCGCCAAGCGTGAAAGCCTGTTGGGGTTCACCTTCAAGCTGGATGCGGTTGACGCGTTCGACGCCTGGCT
GGATGAGTATGACGAGCACTACAGGCGGCTTCTCACTCAATTGCATGAGCAGGTCATCGATCGGCTGGAT
GTACTGGGCAAGACAGCACCGTGCGTGCGCCTGTTCTCACTGCATGCACAGCTGATCGGGTTGCGCCCCA
TACTGCAGGCATTCTTGCGCGAAACCCTGGCGAGTGACCGGTTCACCACGCCACCCTTGGTGCGTGGTGT
GTACTGGTCGTCAGTGGTACAGCAAGGCGACATGCGCAATGCCTTTGTCCGTGAAGCGGCTCAGCCCTAC
ACGACGAAGCTACCCCTGCGTGAAGGTAAGGCACAGGGGAAGGCGTTGGTCTATTTCATCCAGCAAGCAT
TCAGGCGGGTTATTTATCAGGAAGCCGGGCTGGCGGGCGACAATGTTCGGGTTGCGCGCAGCAAGCGCCA
CTTGCTGTGGGTGGGCTCTGGTGTAGGCATCCTGGCGTTCAGTATCGCCATTGCCAGCTGGCAGCGTTAC
GCCGAGATCAATGGCGCCAAGGCTGCCAGTGTGCTCGCCAAAAGCCAGGAGTACAGTGGTCACGAAGTCG
ATATGCGTCTTGATCCGACCGGGCGCAACCTGCTGGCGCCACTGGACCAGATTCGCGATGCGGTGGCGGT
GTTTGGCGACTATCGTGCGGCCTGGCCGGTGGTTGCCGATTTTGGCTTGTATCAAGGGCGCAACATTGGT
CCCTTGGTTGATGAGGCGTACCTCAGCTTGTTGTCGAAACGTTTCTTGCCGGCCTTGGCCAGTGGTGTGA
TCGATGCCATGAACGCTGCACCACCTGGCAGTGAGCAACAAATGGCCGCGCTCAGGGTTTACCGGATGAT
CGAGGACCGCAACAGCCGCCGGCCAGAATGGGTCGAGGGCTGGATGGCCCGTCAGTGGCAACGGGCCTTT
CCTGGCCAGGGTCAGTTGCAGCGTGACCTCATGCAGCACCTGAAGTACGCCTTGGCCTATGCCGATACCG
ATTTGCCGCAATACCGCCAGCGGGTCAGCGAAGTGCAGCAGGTGTTGCGCAAATTGCCGTTGCCACAGCG
GGTCTACGCAGGGCTGAAACAACAATCGTACGAGCAGGTGCACGCCGGGCTGGACCTGCGCCACCAGGTA
GGGCCTGCGTTCGATGTGGTGTACCAGCCGTCTTCCGGGTCAAGGCAAGGGGGGGAGGATGTAAGGCTGG
CCGGCATGCTCACCGCCAAAGGCTTCAGGGATTACTTCGAGCCGCACAGCCAACGCTTCGCTGAAATGGC
GATGGTTGATCAATGGGCATTGGGGGAGCGCAGTCAACTCGACTATTCGGACGTCGACCGCGATGCGTTG
ACCGAGCGGCTGTATAACCTCTACAGCGCCGATTACATTGACAGCTGGCGGCGCGCCCTGAACGCGTTTA
CGGTGGCTGACTTCCGTGATATGGACCATGGTGTCGCGATCCTGGAGCAGTTGACCGGCCCCGCAGCACC
GTTGCAACGGCTGCTGGATACGGTCAGGGATAACACCTCGCTTGCGTCTCCAGCAGTTGTTGAATCACCG
GGTGAGCTGAGTACGCTGCGGGTAGCAACCGGAAAACCCGAGCAACCGCAAGCGTTGGCCATCCAGCGGG
CGTTTGCAGGCCTGGGCGCCATGCTGCAGGCGACAGGAGAAAAGCCGAGCTACTACGATGAAACCCTTGG
CGCTGTTGCGGCCGTGCTGGACTACGCCAAGGCCGTACAGGACAGCCCGGACCGCGGCAAGGCCGCGTTG
CAAGCCGTGCATCAGCGCTTTGCGATGACAGGGCAGGACCCGATCGGTACCCTGCAACGTGTTGCCACAG
GTTTACCGGAGCCTATCAGCCACCAGGTCAGAAAGCTCGCCGACCAGACTGCCCAGGTGCTGAACGTTGA
AGCACTGCGCGAACTGGAGCGACGTTGGGATGCTGACGTGTACAGTTTTTTCCAGCAACGCCTGGCAGGC
CGCTACCCCTTTGTGGTGAAGGCACCCGATGCTTCTTTGGATGACTTCGAGGCGTTCTTCGGGCCGAAAG
GGCGCCTGCAGCAGTTTAATGATCGGTATCTCAAGGTTTTCCTGAAGGACAACCTTGAGGCTTTGCAGTC
CGCTCAGCACGGGCAATCCCTGATTCGTGCCGACGTGATCGAGCAGCTCGAGCTGGCGGAGCGCATCCGC
GAAACCTTCTTCGATCAGCGTGGCCAGCTGAGTGTGCAGTTCAGCATCGAGCCCTTGGGGCTCAGTGCGA
ACCAGCGTACCAGCCTGCTGGACCTGGATGGCCAGTTGATTGCCTACACCCATGGCCCAAGCCATATCAC
GGGTATTGTCTGGCCCAATACCCTGGGGCAGCAGGTCCGTAGCAATCTCACCTTGCTAAGGCAAAATGGC
AACAGCAGCAGCCTGGAGTACCGTGGCCCGTGGTCGATGTTCCGCTTGCTCAGCCGCGGCGCGCTCAATG
GCCGGACGGCGACCAGCGTGGACCTGAGCTTCCGGACCGGAGATGGCGTGATGCGCTATCGGCTTAACGC
TGAAAAAGCCTTCAATCCCATTACCCAGCAACCGTTCAAAGGCTTCCGCTTGCCCCGAGGCTTATTGCAA
CAGCCAGCCAATGGGGTGCAGGCGGCGCTATCGGATGAGCAGCGACTATGA
 Primer design