SecReT6
Protein ID: 148547847
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2631
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3002412..3006215 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA5W3Q5
KEGG IDppf:Pput_2631
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.70E-60, Aligned region: 181..434
IcmF-related [PF06761], Evalue: 3.10E-45, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 3.10E-45, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 2.70E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 458..458
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 881..939
Protein Sequence: 1267 a.a.     [Download]
>gi|148547847|ref|YP_001267949.1| unnamed protein product [Pseudomonas putida F1]
MKTLLRLLKSFWVLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRTNGLHAVLKTRLKKLQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLDHFTRGHR
GGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDR
DLILYQSRLGRQAAFSPLLLGLVAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAADREQQLAAGKG
LEVLREQMANVEAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPQPKKRNGKPLAPAIAARAQAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEML
GRLDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAAEGTPADAGVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRTLLYGTAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWSKVTGLFDAND
TLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDV
VTLSGTRVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNSRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3002412-3006215 Pseudomonas putida F1 chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGGTGCTGCTGCCATTGCTGTGGCTGGCTAGCCTGT
TGATTTGCTGGCTGGCCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTGCCTGAAGCGCTGGCAATCAT
CAGTGCCTGCTTCCTGCTGGTAATCGTGCTGCGCCAATACCAGCGCATTCGCGCCGAACACAACCTGGAG
AACCTGCTGCAGATCGAGGTCGACCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GTGAGCGCCTGAAGCACGCCATCGCCATGCTGCGCACCGACCGCTCCGCGGGTGGCGGCGGCAAGGCGGC
CCTGTCCGACCTGCCCTGGTACCTGGTGGTCGGCATGTCGGCGGCCGGTAAGACCTCGCTGCTGACCCAT
TCCGGCCTGTCGGCCAGCATCGCTACGGCCAACGACAGCGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCCGTGATGATCGACACCGCCGGGCGCTACCTGCGCGACGACCAGTCGGCCAGCGAGTT
CTCGGCCTTTCTGCGCATGCTGCGAAAGCAGCGCGGCAAAGCGGCGATCAATGGCCTGGTGCTTGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCGGCCCAGTTGGTGGCACGGG
TGGAAGAATACGCCGAATGCCTCGATGCCAACCCGCCGGTTTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGTTTCAGCCAGGCTTTCGACGGCCTCGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTTTCGGAAATCCGCACCAACGGCCTGCACGCCGTGCTGAAGACGCGCCTGAAGAAACTGCAGGCTC
ATATTCGCCAGCACGTCGACGCACAGATGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGCTGAATTT
CCCGCAGTACTTCGCCGCCCTCAGCGGTGTGCTCGAGCAATTCCTCGACCACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTACGTGGCCTGTACTTCACCAGTGCACTGCAGAACGGGCAGCAACTGGGGC
AGGTCTATGAAGACGTCATCGCCGACGAATTCGCCCTGCAGGCGGCCTACGATGAGCAGGCCGGGCACGT
CGGCAAGGCCCTGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATCTTCCCCGACCGC
GACCTGATCCTTTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTACTGGGCCTGGTCG
CCGCCACCGGGTTGCTGTTCATCGGTTGGCAAGCGCTGTCGTTCGCCAATAACCGCCAGTGGCTGGACAG
CCTGCGTGGGCAGCTGGCGCACATCGAGCAGGCAGCAGACCGCGAGCAGCAGCTGGCCGCAGGCAAGGGC
CTGGAAGTGCTGCGTGAGCAGATGGCCAACGTCGAGGCCCATCGCCTGCAGGGAGTGCCCTTGCAGTTGG
GTGGCGGCCTGTACCAGGGCGAGGCGATTCACCAGGTGACCCGCAGCGCCTACCTGGCGCAGCTGCGCAG
CCAGGCGCTGGAACCGATCGCACGCAGCCTGCAGGTGCAGATGCGGGCGTTCAACACCTTCGCCAACGGT
ATCAATCAGGAGCTGGAATTCACCCCGGCCCCGCAGCCGAAGAAGCGCAATGGCAAGCCGCTGGCCCCTG
CCATTGCGGCCAGGGCCCAGGCCGCGCTGGGCAACACCCGCGCTGGCGCCTATGCCGCCAAGGTCAACCT
GGCCACTGCCAGCGATGGCGCCGAGCTGTCCGCCGCCACCGGTGGGCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTGGACGAGCAGCAGGTGGCCTCGATCATCGAGGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCCCAGGCCCATCCAGACCCGGCCTTCGTCGCTGCCAGCCTGCCCCAGGCCTGGGCCAGCGC
CGCCGCCGAAGGCACCCCGGCCGACGCTGGCGTGATCGCGGAAAATGCCCCGCTGTACGTGCAGTTGCTG
GAGCAGGGCCAGGCGCCGTCGTTGCCGCGCAACGAACAGCTGATCAACGAAACCCGGCAGAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAGTACCTGCGCCTGCAGCTCGAGTCGAGCCGGCAGTT
CCCGGCGCTGAGCCTCAACGACCTGGTCCCGCAACCAGGCCGCACGCTGCTGTACGGAACCGCGGGTGTG
CCGGCGATCTACACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGCGAAGGCGGCGATGCCATCGTGCAGAAGGCCAACTT
CGTACGCGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTT
GGCGTGCGCCACTTCGCCGACCTGGCCTCGGCGACCCGGGAACTGGGGCTGTTGAGCGACGTGCAGAACT
CGCCAGTGAAGAACCTGCTGCAGGCCGTCAACGACAATACCCAGTGGGACCTGCCGGTCAAGCAAGCCAT
CCCGGCCCCCGGCACCAGCCGCGATGACGGTTTCTGGAGCAAGGTCACCGGTCTGTTCGACGCCAACGAC
ACCCTGCCTGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAGC
CGGTGGCGCGGGTGTTCGCTGAAAACAACGCCGAAGGTGCCGACAGCACCATCATGGACCGCTACCTGGC
CGCCTTGCGCAAACTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGCAAGAGCAGCAAA
CAGTTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAGATCACCACCGTGCGCAACTACGTGGAAAGCA
GCGTCGACACCAGCCAGGATGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCCATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCGAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCC
TGGGAGCAGGTCATGGCACACCGTTACCCGATTGCCGGCAGCAGCCGCAACGAGGCTTCGGTGAAAGACC
TGCAACGCTTCGTAGATCCCGACAGCGGCCTGCTGCCGGCCTTCAAGCGCAACGAAATCGGCAACCTGGC
CGGTGGTGAAGGTCTGGGTGTGGGCGATGGCAAGGGGCCGGCGCTGGTCAACCCTGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCGGACCGTGACAACGGCTTCGAAATCA
TGCTGGAGCCTTCAGCCAACTTCACCGACATCGTCTTCACCCTCGATGGCCAGGAGCAGCACTACCGCAA
CGGCCGCAGCAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCACCGCGCCGGGCGCGCGCCTGGACGTC
GTCACCCTGAGCGGCACACGGGTCACCGTGTTCGATTTCCCAGGGCGGTGGGGCCTGCTGCGCATGAACG
AGAGCGCTCGCGTCGACGACCTGGACGGCATTCAGCAACGCTTTAGCTGGAACACCGCCAGTGGCCGCGT
AAGCCTTGTCGTGCGCAACTTCGGTGGGGTCAAGCTGACCGATCTGGGTGACGTCAAGGCCCTGAGCGCC
CTCAACAGCAGGGGCGCGCAATGA
 Primer design