SecReT6
Protein ID: 148547849
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2633
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]3007117..3009612 [+]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDA5W3Q7
KEGG IDppf:Pput_2633
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-67, Aligned region: 90..111
ImcF-related_N [PF14331], Evalue: 3.10E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 5.40E-16, Aligned region: 716..810
IcmF-related [PF06761], Evalue: 1.30E-09, Aligned region: 94..133
IcmF-related [PF06761], Evalue: 1.30E-09, Aligned region: 497..637
Protein Sequence: 831 a.a.     [Download]
>gi|148547849|ref|YP_001267951.1| unnamed protein product [Pseudomonas putida F1]
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNL
EGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQMLRQHRQRRPL
NGLIVSVSIADILHGSVEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQLVQQDIQVTRRNDAAYRFPLELAALKPRLHQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIADELAQAKADDQAASG
QYTAWRSLDRLRFWAAHYHEQHHAKGVPLSMRLGLYQGHEVEPLLRNRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLP
DYWYPAIARHTGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRAIETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3007117-3009612 Pseudomonas putida F1 chromosome, complete genome
ATGAACAAGCTCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGCGTGGCGTTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCCGAGCCTTCGGCTTCGCCTCGCTGCACAGCCTGCTGGCCGGGATCGG
CGTGTTTCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTGTACCGCGGCGTGGGTCAGCACCACAACCTT
GAAGGCCTGCTGCGGGACGACGCCGACCAGGCCGTACTCAGTGCAGCCCCGGCCGACCGGGAAGAAGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGGGCATCGAGCGCCTGCACAGCAACAAGCCGCGCGGTACTTCGAA
CAAGGATGCCCTGTATGCCCTGCCCTGGTACCTGGTCATTGGCCAGCCTGCCGCCGGCAAGAGCACGATG
ATTTTGCAGTCGGGCCTTAACTTCCCCTATGCCGAGCGCGAAGGCGTGCGGGTCGCGGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCTGAAGCGGTACTGCTGGACACTGCCGGGCGCTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGCGGCTTTTTGCAAATGCTGCGCCAGCACCGCCAGCGCCGTCCCCTT
AATGGCTTGATTGTCAGCGTCAGCATCGCCGATATCCTGCATGGTTCGGTCGAAGACCAGGAGCGCGTGG
CCAAGCGCTTGCGCGAACGCATTCAGGAAAGCTGCGCGCTGCTGGAAGTGCGTCTGCCAATCTACCTGGT
TTTCACCAAATGCGACCTGATCCCTGGTTTCACCGCGTTCTATCGCCAACTGGACGACGCGGCTCGTGGT
GAAGTGATGGGTAAAACCTTCTCTCACAAGGGTTACGAGCAAGCCGACTGGGGCCAGCGCTTCAGCAATG
CGATGGACGAGCTGACGCGTTACTGGGGGCAGATGGCGAGCCAGCAGCTGGTGCAGCAGGACATACAAGT
CACCCGGCGGAACGACGCTGCCTACCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCGCCTGCATCAG
TTCGTCGACAGCCTGCTGCGTGCCAACCCTTACCAGAATGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CGGCGCTGCAGGCCGACGAGGCTCAGTGGGGCTGCCACGGCCAGCATGTGGCCGAACGCTTCGCGCTCGA
ACACGCAGAAGGAACGGGCACTGCCGGCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAA
GTGATCATTCCCGACCAGCATTTGGTGGCGCTGTACACCAGCAACCACCGTGAACGCCGGCGCAAGGCCG
GGTGGGTGGGCGCTGCCGGCCTGGCGGCACTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATTGCCGACGAACTGGCCCAGGCCAAGGCCGACGACCAGGCGGCCAGCGGC
CAGTACACCGCCTGGCGAAGCCTCGACCGCTTGCGCTTCTGGGCTGCTCACTACCATGAGCAACACCACG
CTAAGGGCGTGCCCCTCAGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCAA
CCGCTACTTCGCCACGTTGCAGAATGTAATGCTAAAGCCCACGGCCGATAATCTGACCCGTACCCTGTAC
CTGCTGACCACGCTCAAGGTCTACCAGCGCAACACCCGTGAGCTGCAGCCAGTGAGCGGCATTGACAGCG
TAGAGGCCGAGGCGCTGCCCCATGACAACCGCGCCCAGTCGATCGCCAATTTCGGAAAGGCGGCCCTGGA
CACTTACGTGATGCTTTCTCCGGGCCAGCGCGAGCATGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCG
GACTACTGGTACCCGGCCATCGCCCGCCATACCGGCAAAAGCATGGCCGCCGCCGGCAGCGAGGCCGGTG
GCAACCAGGACTACCTGTATGCCAGCCGCCAGATCACGTTCTACAGCGACCAGATCCGTGAGCCAGATGT
ACCGCGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAACTACATCGACAGCCTGCGGGCCCAG
TCACTGCGTGCCATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCCTTCGGCCGCGCCGACTTCC
AGAGCCTGAAAAACGAAGGCCAGCATCAGCTGAGCGCAATTGCCAGCAAGCTGCTGAACACCCCGAATAT
CGGCAAGATCATCATCTCGGGGCACGCCGACCAACTGGGTGACAGCCAGGGCAACCTGCAGGTTTCGAAA
CAACGGGCGCAAACCATCCGCACCTATCTGGTTGGCAAGGGCGTACCTGCCGAGCTGGTGGTCGCGCAGG
GCGAAGGCAGCCGCAAGCCATTGGTCAACTGCGACATGCAACAACCGCGAACGCAGTTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTGCGTGGGCTTAACTGA
 Primer design