SecReT6
Protein ID: 15130916
SecReT6 ID896
T6SS typei3
Gene symbolsciA
Locus tagsciA
StrainSalmonella enterica subsp. enterica serovar Typhimurium SR11
Repliconchromosome [GenBank: AJ320483] [Browse all T6SS(s) in this replicon]
Location [Strand]322..1377 [-]
ProductSciA protein
NoteTssA
UniProt IDH9L4K7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 224..241
Protein Sequence: 351 a.a.     [Download]
>gi|15130916|ref|CAC48198.1| SciA protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDASLARSNALAALLDHEG
VMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQ
VWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGI
SLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDAL
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|15130915|gb|AJ320483|sciA|:322-1377
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGTCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGC
GTGATGGCGGACATTCGCGGTATTACGCTGTCAAACAGTGCCGCCCTGCGCCTACAGGTACGGGATGTGG
AGCGCGCGTTATCCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGA
CCTCGAAGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAA
GTGTGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGC
TGCCTGACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGG
CACGGTTATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATA
TCCCTCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCA
TTCGTCGCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACT
GGTGGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTG
GAGTGA
 Primer design